KEGG   Carnobacterium maltaromaticum: BN424_840Help
Entry
BN424_840         CDS       T02342                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07260  
zinc D-Ala-D-Ala carboxypeptidase [EC:3.4.17.14]
Organism
cml  Carnobacterium maltaromaticum
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Two-component system
Brite
KEGG Orthology (KO) [BR:cml00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN424_840
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN424_840
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BN424_840
Enzymes [BR:cml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.14  zinc D-Ala-D-Ala carboxypeptidase
     BN424_840
Peptidases [BR:cml01002]
 Metallo Peptidases
  Family M15: zinc D-Ala-D-Ala carboxypeptidase family
   BN424_840
Peptidoglycan biosynthesis and degradation proteins [BR:cml01011]
 Peptidoglycan biosynthesis and degradation
  Carboxypeptidase
   BN424_840
Antimicrobial resistance genes [BR:cml01504]
 Gene sets
  Vancomycin resistance modules
   Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]
    BN424_840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
898860..899633
Genome map
AA seq 257 aa AA seqDB search
MNKKIIISLFSLTLLSGCQFIGENTAKDSTDNTNKTTKTSTTEKDKATEEKVAIAPLPNV
STADWNLLLVNSDFPMDPTREIPLAVVDNGLQIDQRMEADYQAWMEAARNAGFNMELISA
YRSIDLQQTVYDQSIQDNVAKGMSQEEALKETKEYVAFPGASEHHSALAIDIVDDQWLAT
GKGLIPEYDQTDSQKWLVKTMQDYGFILRFPKDKESFTKISYESWHFRYVGKENAKYIVD
NHLSLEEYIERLKAAGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaataatcatctctttattttctctaactttgcttagcggatgtcagttt
ataggtgagaatacagcaaaagattcgactgacaatacaaataaaactacaaaaacgagt
actactgaaaaagacaaagcaactgaggaaaaagttgcaatagcaccattaccaaacgtc
tcaacagccgattggaacttattattagtgaattctgattttccaatggatccgacaagg
gagattcctttagcagttgtagataatggtttacagattgatcaaaggatggaagccgat
tatcaggcttggatggaagctgctagaaatgcaggttttaatatggaattaatttcagcg
tatcgttcaattgatttacagcaaacggtatacgatcaatcgattcaagataacgtagca
aaaggcatgagccaagaggaagccttaaaagaaaccaaagaatatgtagcatttccagga
gcaagtgaacaccactcggctttggcgattgatattgtagatgaccagtggcttgcaaca
ggtaaaggtttaatcccagagtatgatcaaacagactcacaaaaatggttagtcaaaaca
atgcaagattatggttttattcttcgtttcccaaaggataaagaaagctttacaaaaatc
agttacgagtcatggcattttagatatgtaggaaaagagaatgctaaatatattgttgat
aatcatttaagtttagaagagtatattgaaagattaaaagcagctggtaaatag

DBGET integrated database retrieval system