KEGG   Carnobacterium maltaromaticum: BN424_842Help
Entry
BN424_842         CDS       T02342                                 

Gene name
lytG
Definition
(GenBank) mannosyl-glycoendo-beta-N-acetylglucosaminidase family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
900094..900726
Genome map
AA seq 210 aa AA seqDB search
MVLKKGNKNLKKLKSIKIIPSYLVASIFISCLVFFGTLSFLSSRENAQQAQVAVEIDQEQ
AFIDKISAYAKVLQSEYGVLPSISIAQAILESNWGNSELSEKYNNFYGIKGSEEANTVLM
NTKEFVDEEWIEINGRFRIYESWQDSMNAHTKLFVEGTTWNPQQYAAVLAADNYRDAAFA
LQASGYATDPTYPEKLIELIQQYKLDQFDK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggtactgaaaaaagggaataaaaatttaaaaaagttaaaatcaattaaaatcattccc
agctatctagtcgctagtatttttattagttgcttagtattttttgggacactttctttc
ctttcaagtcgtgagaatgcgcaacaagctcaagttgctgttgagattgatcaagagcaa
gcttttattgataaaatttcagcttatgcaaaagttcttcaatctgaatatggtgtgttg
ccaagtattagtattgctcaggctattctggaatctaattggggaaatagcgaactatct
gaaaagtataataacttttatggaattaaggggagtgaagaggcaaatactgttttgatg
aataccaaagaatttgttgatgaagagtggattgaaataaatgggcgttttcgaatttat
gaaagttggcaagattcgatgaatgcacataccaaactctttgttgaaggaacaacttgg
aatccgcaacagtatgcggctgttttagctgctgataattacagagatgctgcatttgca
ttgcaagctagtggttatgccacagatccaacttatcctgaaaaattgattgaattgatt
cagcaatataaattagatcagtttgataaataa

DBGET integrated database retrieval system