KEGG   Carnobacterium maltaromaticum: BN424_846Help
Entry
BN424_846         CDS       T02342                                 

Gene name
gmuR
Definition
(GenBank) HTH-type transcriptional regulator gmuR
  KO
K03492  
GntR family transcriptional regulator
Organism
cml  Carnobacterium maltaromaticum
Brite
Transcription factors [BR:cml03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    BN424_846 (gmuR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
904479..905198
Genome map
AA seq 239 aa AA seqDB search
MAKYSQIADEIRKRILAGRYAVDHALPDQGKLAAEFETSRITIKKAIELLVVEGLVYSRQ
GSGTYVRKNALEMSKLDSKMDEYVGVTHQLADRSTITSQILHFDVRFPTDIEAEKLMLTK
TQPVYAIDRLRLLSGEPFLIEHTIMPVEVIPNITKEILLNSIYHYIKGELGLKFGGANQH
IRADKPNELDQKYLKCAQDDPVLEIDQVVYLTDGVPFEYSQTRHRYDQGDILVVTINSV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatacagtcaaatagcagacgaaattagaaagagaattttggcagggcgttat
gcagtggatcatgctttacctgatcaaggaaaactagcagctgaatttgagacaagccgg
ataactataaaaaaagcaattgaacttttagttgttgagggactagtatacagccgtcaa
ggttcagggacctatgttcgaaagaatgctttggagatgtcaaaattagatagtaaaatg
gacgaatatgttggtgtgacacatcaactagcggatcgaagtacaattacaagccaaatt
ctacattttgatgttcgctttccaactgatatagaagctgaaaaattaatgctgactaaa
acacaaccagtgtacgctattgatcgtttacgtttactttctggtgagccttttttaatt
gaacatacaattatgcctgtcgaggtgattccaaatataacgaaagagattttattgaat
tcaatttatcattatataaaaggtgaattagggttgaaatttggtggagcaaaccaacat
attcgagcagataaaccgaatgaattggatcagaaatacttgaaatgtgctcaagatgat
ccggttttagaaatcgatcaagttgtttatttaaccgatggcgttccttttgaatattca
cagacaaggcatcgatatgatcaaggggatattttagttgtaacgattaatagcgtttaa

DBGET integrated database retrieval system