KEGG   Carnobacterium maltaromaticum: BN424_848Help
Entry
BN424_848         CDS       T02342                                 

Gene name
pbuX
Definition
(GenBank) xanthine permease family protein
  KO
K16169  
xanthine permease
Organism
cml  Carnobacterium maltaromaticum
Brite
Transporters [BR:cml02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BN424_848 (pbuX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
906482..907810
Genome map
AA seq 442 aa AA seqDB search
MLSNGKSAALGLQHVLAMYAGAVIVPLLIGGALNFTPEEMTYLVSIDIFMCGVATLLQLT
VNKFFGIGLPVVLGCAIQAVSPLILIGSNQGIGAMYGSIIVAGIFIILISGVFSKIKRFF
PPVVTGTVITVIGLTLIPVALEKMGGGSKIMTDFGSTKFLVLAFVTIATILIVQIYGIGF
MRSIAVLIGLLVGTGLAAFLGMVNLAPVAEATWFHMPQPFYFGRPTFEWSSILTMILISL
VSMVESTGVYFALGEITDKKIQEDDLKRGYRAEGLAVLLGGIFNTFPYTGFSQNVGLVQL
SGIKNRKPIYFSAGFLILLGLLPKIGAVATIIPDPVLGGAMLVMFGMVATQGIRMLAHVD
FTNESNLLVVAMSVGLGLGVTVVPELFAGLPETVQLFTSNGIVVASLTSIILNVLFNKKE
RGKVDLETSTVGSEFAETGNSH
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaaatggaaaatcagctgctttaggcttgcaacatgttttagctatgtatgca
ggtgccgttattgttccacttttaattggtggagcattaaatttcactccggaagaaatg
acttatttagtatcaattgatatttttatgtgtggagtagccacattattacaattaacc
gtcaataaattttttggaattggcttaccagtcgtactaggttgtgctattcaagcggta
tcccctctaattttgattggatctaatcaaggtattggtgctatgtatggctcaattatt
gttgcaggaatttttattattttaatttcaggggtcttttctaagattaaacgttttttt
ccaccagtcgtgacaggaacggttattaccgttatcggtttaacgctaattccagttgct
ttagaaaaaatgggtggcggcagtaaaataatgacagattttggctccactaagttttta
gtgttggctttcgttacaatcgcaacgattctaatcgttcagatttatggtattggattt
atgcgctcgattgctgttttgattggtttattagttggaacaggtttagcggcattttta
ggcatggtaaatttagctccagttgcagaagcaacatggttccatatgcctcaacctttt
tactttggtcgaccaacctttgaatggtcatctattttaaccatgattttaatttcatta
gtgagcatggtagaatcaacaggtgtttactttgctttaggtgaaattacagataaaaaa
attcaagaagacgatttgaaacgtgggtatcgagcagaaggtttagcggtattgcttggt
gggattttcaatacatttccctatactggattttcgcaaaatgtaggacttgtccagtta
tctggaattaaaaatcgtaagcctatttatttttcggctggttttttaattcttttagga
ttactacctaaaattggtgcagttgcaacgattattccagaccctgttttaggtggtgct
atgctagtgatgtttggcatggttgcaacacaaggcataagaatgctggctcatgtcgat
tttacaaatgaaagtaaccttttagtagttgctatgtccgttggtttaggattaggtgta
acggtcgttccagagctatttgcgggcctaccagaaacagttcaattgtttacaagtaat
gggattgttgtagcaagcttgacctcaatcattttaaatgttttattcaataaaaaagag
cgtggtaaggtggatttagaaacaagtacagttggcagtgagtttgctgaaactgggaat
agtcattaa

DBGET integrated database retrieval system