KEGG   Carnobacterium maltaromaticum: BN424_855Help
Entry
BN424_855         CDS       T02342                                 

Definition
(GenBank) sodium:dicarboxylate symporter family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
912889..914190
Genome map
AA seq 433 aa AA seqDB search
MVKFLKNYKSSLTLLAGIAVGAIIGVFFGEAALFLEPIGKLFLNCVFVLIIPLIFCSMSL
AVAGTGKQGVSRIKKILGLTLGTFAITTLIAVTLMYVATLVYNPFASIDRNQFSALMDQN
LVAESQSFGMMIVNTISVGNFLDLFDKSNLLALILFSLFFGITLSLIGEKASPILAVLNV
GNDVTMKMIALVMKFAPIGLGSYFAYTLGELGPKILGGYMKALLLFILICGIYFIFILSF
YAYIAGGLRGLKLYWQNIFIPALQALGTSSSAACIPTNLAALKKIGVPEDIRETVISLGA
NIHKDGSAMSGVLQVVLLFTLFNRDLTTLSAGLSIICGGFLVGIVMGSIPSGGFTAEVLL
IALFGFPVEVIPVIAVITTITDMTATLVNSTSNITCAMMITKVIEKESLTHKFYETECSS
ENQGIKGSPKELS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaatttttaaagaactataaaagctcgttgacactcttagctggtattgcagtt
ggagcgattattggggtgttttttggtgaggcagcactctttttagaaccaattggcaag
ctatttttaaattgcgtatttgtactgattattccattgattttttgcagcatgagtttg
gctgtagcaggtactggcaaacaaggtgtaagtcgtattaaaaaaattctaggcttaaca
ttgggaacctttgcgataacaaccttaattgctgtgactttaatgtatgtggcaacgctg
gtttacaatccatttgctagtattgatcggaatcaattttcagctttaatggaccagaat
cttgtagctgaaagtcagtcttttggaatgatgattgtcaatacaattagtgttggaaat
tttctagacttatttgataaaagtaatttattagcgttgattttattctctttattcttt
ggtataacactgtctttaattggagaaaaagcttcacctatattggctgttttaaacgtg
gggaatgatgtaacaatgaagatgatcgcacttgtaatgaagtttgcaccaattgggtta
ggatcgtactttgcttatacgctaggtgaactcggaccaaaaatcttaggtggatatatg
aaagctttgctgctttttattttgatttgtgggatttactttatctttattctttctttt
tatgcttatatagctggaggtttgagagggcttaaactttattggcaaaatattttcatt
ccagccctacaggctttaggaacgagttccagtgctgcttgtattccgacaaatttagca
gctttaaaaaaaataggcgtgccagaggacattcgagaaacggtgatttctttaggtgca
aatattcataaagatggttcagctatgagtggtgttttacaagtagtcttactatttacc
ttatttaaccgcgatttgacgacactttcagcaggtttaagtatcatctgtggtggattc
ttagttggcattgtgatgggatcaattcctagtggtgggtttactgctgaagtattattg
attgctttatttggtttccctgtggaagttattccagtaattgcagtcatcacaacgatt
acagatatgactgcgacattagttaattcaacaagcaatataacatgtgccatgatgatt
acaaaagttattgaaaaagaatcacttactcataaattttatgaaactgaatgtagtagt
gaaaatcaaggcatcaaaggcagcccaaaggaattaagttaa

DBGET integrated database retrieval system