KEGG   Carnobacterium maltaromaticum: BN424_858Help
Entry
BN424_858         CDS       T02342                                 

Gene name
pblT
Definition
(GenBank) major Facilitator Superfamily protein
  KO
K08177  MFS transporter, OFA family, oxalate/formate antiporter
Organism
cml  Carnobacterium maltaromaticum
Brite
Transporters [BR:cml02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Oxalate:formate antiporter (OFA) family [TC:2.A.1.11]
    BN424_858 (pblT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Nodulin-like IncA
Motif
Other DBs
NCBI-ProteinID: CCO10322
UniProt: K8E2L7
Position
917573..918778
Genome map
AA seq 401 aa AA seqDB search
MSEIKKKVGMNRWAILFASVGIIICQGGIYAFSVFATPIAKANGWNVSDVMFAFTIAIAI
SPLPMVIGGIISDKGKSRELILFSSLLLAVAFILTGFATEKWMLYLTYGVFGGFGLNLGY
IACINNCIRFFPDKKGLASGIVITGIGIGTMIFAPLSAWMIENLTIRMTFVVLGAIYTVI
SLICCLIIRNAPIVAKDVEIAEDTPIDHKWNEMLRKPLFYIIVLMYAAGGFSGLMISSNA
ADIGQNMFNLTPILAATFVSIYALSNCLGRVFWGGLSDKLNRTNTMILIFISIAISLLAF
IFIHSVAGFAIGMIGLGLCEGGVAAVMPPITIESFGNKNQGVNYAFVFAGYSIAAMVAPK
LSAMIGEKNDGNFTQAFMIGFGLALVGVALTFVYKAMRKAI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagatcaaaaaaaaggttggaatgaatcgctgggcgatactatttgcctcagtt
ggaattattatctgccaaggtggtatttatgcatttagtgtatttgcgaccccgattgct
aaagctaatggttggaatgtttcagatgtcatgtttgcttttacaattgcgattgccatt
tcaccgctaccaatggtaattggcggtattatttcagataaaggtaagtcgagagaatta
attttatttagttctttactgctagcagtagcctttattctgacaggttttgcaacagaa
aaatggatgctgtacttaacttatggcgtctttggtggatttggtttgaacttaggttac
attgcctgtattaataactgtattcgtttttttcctgataaaaaaggcttagcatcggga
attgtgattactggaattgggattggaacgatgattttcgcgccactatctgcttggatg
attgaaaacttaactatcagaatgacatttgttgtcttaggtgcaatttatacagttatt
tcgttgatttgttgtctaattattcgcaatgctccgattgttgctaaagatgtcgaaata
gcggaagacactcctattgatcataagtggaatgaaatgttaagaaaaccactcttttac
attattgtattgatgtatgcagctggtgggttttcaggtttaatgatttcatccaatgct
gcggatattggtcagaacatgtttaatttgactccaatcttagcagcaacatttgtgagt
atttatgcgttaagtaattgtttgggacgtgttttttggggtggtttatcagataagtta
aatcgaacaaacacgatgattttaatttttatatccattgctatctcattactagccttt
atttttattcactccgttgctggttttgctatcggtatgattggtttaggtttatgtgaa
ggcggagtagctgctgtcatgccaccaattacaatcgaaagctttggaaataagaatcaa
ggtgtaaactatgcctttgtttttgcagggtattcgattgcagctatggtagcgccgaaa
ctatcagcaatgattggtgaaaaaaatgatggaaattttactcaagcttttatgattgga
tttggtttagcacttgttggggtagctctgacatttgtgtataaagctatgcgaaaagca
atttaa

DBGET integrated database retrieval system