KEGG   Carnobacterium maltaromaticum: BN424_863Help
Entry
BN424_863         CDS       T02342                                 

Definition
(GenBank) hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4003
Motif
Other DBs
NCBI-ProteinID: CCO10327
UniProt: K8E2M0
Position
921978..922754
Genome map
AA seq 258 aa AA seqDB search
MFTNLTSTVRASIASLLIANEMNTNRYYHELADNYQLLLDSGFKRSEFTYFTAYQLLHSE
VQDRKKIVREGKAIFEAIQNNHRFLKGRSSCSMAILIAQFNLDKKATEIAGIVDYYFQEL
SQIGFRKNEQLYYLAALGAMFYQSQQPIFINQIQCILNQLDEMEIPLKPLYYTTIGILAF
TQGDQTKLMNEKELSEFIQEIRLLPGMRFQKEISFALGLSLYTEKLNSNLSSLEMESLLL
ALQIQIFKENQRVYSAST
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgtttacgaatttaacaagtacagttagggcatcaattgcaagtttgcttattgccaat
gaaatgaatacaaatcgctattaccatgaactagctgataattatcagcttttgctcgat
tcaggatttaagcgttctgaattcacttattttacagcctaccaattgctacattcagaa
gtacaagatcggaagaaaattgtcagagaagggaaagctattttcgaagcaattcagaat
aatcatcggtttttaaaggggagatcaagttgttcaatggctatcctgatagcacaattc
aatcttgataaaaaagccacagaaatagctggaatagtagactattacttccaagaatta
agtcaaattggttttagaaaaaatgaacagttgtattatttagctgctttgggagctatg
ttttatcaatcccagcaacctatttttatcaatcaaattcaatgtatcttaaatcagttg
gatgaaatggaaattccattaaaacctctttattatactacaattggtattttagcattt
actcaaggcgatcaaactaaattaatgaatgaaaaggaattaagtgagttcatccaagaa
atacgattactaccagggatgcgattccaaaaagagatttcttttgccttagggttaagt
ttatatactgaaaaattaaattcaaatttaagtagtcttgagatggaaagcttattatta
gctttgcaaattcaaatttttaaagaaaatcaacgagtttacagtgcttcaacctaa

DBGET integrated database retrieval system