KEGG   Carnobacterium maltaromaticum: BN424_866Help
Entry
BN424_866         CDS       T02342                                 

Gene name
yoaT
Definition
(GenBank) conserved hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF817
Motif
Other DBs
NCBI-ProteinID: CCO10330
UniProt: K8E2R6
Position
924776..925573
Genome map
AA seq 265 aa AA seqDB search
MSFIRGLLQFTYQQVLCCLFPGAIFFALIVTKYFSIPGIARYDLLLFICILIQVLLLYFK
LETVDELKVIMLFHVIGLVLEIYKVNIGSWSYPGAGFWKLGGVPLYSGFMYSSIGSYICK
AWKVFDLQLSNWPNQKLVITLSLAIYANFFTHHFIWDFRWILILLVFILFYRTWVYFTVG
GKVLKMPMSFSFFCIAFFIWVAENIASFFGAWAYPDQLARWQLVHIGKITSWYLLIIISI
MIVAELKLKKTSHLFNESTEIKSNN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttattagagggttactacaatttacgtatcagcaagttctgtgttgtttattt
ccaggcgcaattttttttgcattaatcgtaacaaaatatttttctatacccggaattgcc
agatatgatttgcttttatttatttgtattttaattcaagtattgttactttattttaaa
ctagagacagttgacgagttgaaagtaattatgttatttcatgtaataggtcttgtttta
gaaatctataaagtcaatatcggatcatggagttatccaggcgcaggtttttggaaatta
ggtggcgtgcctttatatagtgggtttatgtattctagtattggaagttatatttgcaaa
gcttggaaagtttttgatttacaattgagtaattggccaaatcaaaaattagtgattact
ttaagtttagctatatatgctaatttttttacgcatcattttatttgggatttccgttgg
attttgattttacttgtttttattttattctatcgaacatgggtttattttacagttggt
ggaaaagtgttgaaaatgccaatgagtttttcatttttttgtatcgctttttttatctgg
gtagctgaaaatatagctagtttctttggagcatgggcatatccagatcaattagcacgt
tggcaacttgttcatattggcaaaataactagttggtaccttttaattatcattagtatt
atgattgtcgctgaactaaaattgaaaaaaacaagtcatttgttcaatgaaagtactgaa
ataaaaagcaataactaa

DBGET integrated database retrieval system