KEGG   Carnobacterium maltaromaticum: BN424_874Help
Entry
BN424_874         CDS       T02342                                 

Definition
esterase D
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cml  Carnobacterium maltaromaticum
Brite
Enzymes [BR:cml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BN424_874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
931737..932492
Genome map
AA seq 251 aa AA seqDB search
MKKIALPEPFFFENGPRAILLLHAYTGSSNDMRMLGRALEKEGYTVYAPHFKGHGTLDPT
DILAATPADWWLDTQNALAFLREKGYQEIAVFGLSLGGIFATKALEEEGLLAAGTLCSPL
FLNENNHVVDSFLRYVATVQKIAGIEPTKIAESLPKIKIEVQQQLLEIGNYLPPIQMKIP
EITKPFFIAQAGQDELIDSQSAYELKKALVQAAVSFHWYEESSHVITVGRDHHALENDVL
DFLNQLHWNEG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagctttaccagaaccttttttctttgagaacgggccaagagcaatcctg
ttattacatgcttatacaggcagctccaatgatatgagaatgttaggaagagcattagaa
aaagagggatatacggtgtatgctccccactttaaaggtcatggtacattggatccaaca
gatatattagcagcaacgccagctgattggtggttggatactcaaaatgcactagctttc
ttaagagaaaaaggctatcaagaaattgctgtttttggtttatcattaggtggtatattt
gctacaaaagcactggaagaagaaggtttattggcagcaggtacattatgctcgccgtta
tttttaaatgaaaataatcatgttgtagatagctttttaaggtatgttgcaactgttcaa
aagattgctgggattgaacctactaaaatagccgaaagtttaccaaaaataaaaatagaa
gttcaacagcaattactggaaattggcaattatttgccaccgattcaaatgaaaattcca
gaaattacaaaaccgttttttattgcccaagctgggcaagatgaattaattgattcacaa
tcagcctatgaactgaaaaaagcactagtacaagctgctgtttcatttcattggtatgaa
gagagtagccatgtgataacagtaggaagagaccatcatgcattagaaaatgatgtgtta
gatttcctaaatcagttacactggaatgagggataa

DBGET integrated database retrieval system