KEGG   Carnobacterium maltaromaticum: BN424_881Help
Entry
BN424_881         CDS       T02342                                 

Gene name
ftsW
Definition
(GenBank) cell cycle family protein
  KO
K03588  
cell division protein FtsW
Organism
cml  Carnobacterium maltaromaticum
Brite
Chromosome [BR:cml03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BN424_881 (ftsW)
Transporters [BR:cml02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BN424_881 (ftsW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
940539..941663
Genome map
AA seq 374 aa AA seqDB search
MKKIDYYLLVPYLTLIFIGSLMVYSASADVSLVQYGTGTKYFVGQLVFIGAGMTMLVITS
QLKMSFLKNKNLVLCLFFAMLLLLASVLIIGENINGAKRWIDIGFFNIQPVEISKLVLVW
YTAYILSRRQSQMQRNWFKAILPPIVIVGISSLLILLQPDAGSVIIIAIVIVVQIFASGM
PFKIGMISSLAASGVIAGYLKLLTIYGAKMPGMSTYRYARFEAFWNPFELADSSGMQLSG
SYLALGRGGVFGVGLGKSVLKKGYLPEPHTDFILAIIGEEFGLIGVCLILVALSTLILRI
FYLANHTKDSFSSLLCIGIGTMMLIQTGINIGGVIGLVPISGVTLPFVSYGGSSILILSI
ALGLVFNVSRRITK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagattattatttgctagtaccttatctgacattgatctttataggttct
ttaatggtctatagtgcaagcgcagatgtttctttggtacaatatggcacaggtactaaa
tattttgttggtcagcttgtctttattggtgctgggatgacgatgcttgttataactagc
cagcttaaaatgagctttttaaaaaataaaaatttagttttatgtttattttttgcgatg
ctacttttgttagcttcagttttaataattggtgagaatattaatggtgctaagaggtgg
atcgacattggttttttcaatatccaaccagttgaaatttcaaagttagtcttagtttgg
tatactgcgtatattttatctcgtcggcaatcacaaatgcaaagaaactggtttaaagct
attttaccccccattgttatagtaggaattagttctttgctgattttgctacaaccagat
gctggtagtgtcattattattgcaattgttattgtagttcaaatttttgcaagtgggatg
ccttttaaaattgggatgattagtagtttggctgcttcaggagtgattgctgggtactta
aaattacttacgatttatggagcaaagatgccagggatgtcaacctatcgctatgcccgt
tttgaagctttttggaacccttttgaattagccgatagttctggtatgcagttaagcggt
tcctatttagctttaggccgaggtggtgtttttggtgttggtttgggaaaaagtgttctg
aaaaagggctacttgcctgagccacatactgattttatcctagctattattggggaagaa
tttggattgatcggggtttgccttattttggtagcattaagtacgctgattttacgtatc
ttttatttagcaaatcatacaaaagattctttttcttccttactttgcatagggataggg
acgatgatgttgattcaaacgggaattaatattggtggtgtgattggacttgtgccgatt
agtggggttactttaccttttgttagttatggtggatccagtattttaatactatcaatc
gcactggggctagtttttaatgtgagtcgaagaataactaaatag

DBGET integrated database retrieval system