KEGG   Carnobacterium maltaromaticum: BN424_882Help
Entry
BN424_882         CDS       T02342                                 

Definition
(GenBank) acetyltransferase family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 Acetyltransf_4 Acetyltransf_9 FR47
Motif
Other DBs
NCBI-ProteinID: CCO10346
UniProt: K8EPD2
Position
complement(941721..942140)
Genome map
AA seq 139 aa AA seqDB search
MEIREVDSKKNQEMLSTLLENYSQSQNKNIPVYEKKEISLAAYDGATFLGGITGEIFWNH
LHVSLLAIHPDNQKGGVGSRLLEQIELIARENNCTLILLETMSWQAPKFYPKHGYTLFGT
VEDYPIKGEAQYSFQKRLS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggaaattagagaagttgacagtaaaaaaaatcaagaaatgctttcaacgcttttagaa
aattacagtcaaagtcagaataaaaatatccctgtttacgaaaaaaaagaaatttcgtta
gctgcatatgatggtgctacttttttaggcggtattaccggtgaaattttttggaatcat
cttcacgtaagtttattagccattcatccagataaccaaaaaggtggtgttggaagtcgc
ttacttgaacaaatcgaacttattgctcgtgaaaataactgtacattaattttattagaa
accatgagctggcaagcacctaagttctacccaaaacatggctatactctttttggtact
gttgaagattatccaattaaaggtgaggcacaatattcttttcaaaaaagattatcttaa

DBGET integrated database retrieval system