KEGG   Carnobacterium maltaromaticum: BN424_887Help
Entry
BN424_887         CDS       T02342                                 

Definition
(GenBank) mga helix-turn-helix domain protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mga HTH_11 HTH_Mga
Motif
Other DBs
NCBI-ProteinID: CCO10351
UniProt: K8EPD7
Position
944416..945900
Genome map
AA seq 494 aa AA seqDB search
MDILLDKLGTRKVKILELLISEDRYWRLDEIADRIKSSKKTVQLDMKMIQHDIAEWSTDE
IKLDVSSRGSFLKKSNDFYMHKIYLSYIKAGIPYHLFDALFQEDIESLTYFAEDQHVSYT
SFYKQIKELREWLDYYAISIVNNPPAFRGTEKQIRYCGMHIYWRVFKGLEWPFPTIDREP
ILEMIIAAEKVYGHTFNLIEREQTAYWAACAQVRILGGDLIDCVEEFQGIKEGNPLYKEL
EPLILNMFKEMPLSGDALSNEVDYIFSLFNIIPHQIETTELVKDTVGFLKQNQLPSYQAT
ELILDEFLKNLHTIGLKKDNLLLIESLSSIHYHAYLFKADSIRFYFSKFAYNERKYHRLF
YKKFQPIAERLAKIPEVAPIFEQSEFLFNHYIPFIAPYIDWSYYEKIIRVQILTENGRYT
EIKLGKDIINILPHRLEIVSSYQLEPAHEAEVDLIVTDCLITGIDTPVFICKIPPTMGDW
TRLERYISDISMRE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggacatattattagataagcttggcactcgcaaagtgaaaattttagaattgttgatt
tctgaagatcgttattggcgattagatgaaattgctgatagaattaaaagttctaaaaaa
acggtgcaactagatatgaaaatgattcagcacgatattgcagagtggagtacagatgag
attaaactggatgtctcttcaagaggttcctttttaaagaagagcaatgatttttatatg
cataaaatctatttgtcctatattaaagctggtattccgtatcatctttttgatgcttta
tttcaagaagatattgagtcgctaacatactttgctgaagatcagcatgttagttatact
agtttttataagcaaattaaagaattaagagagtggttagattattatgccatctcaata
gtgaataatcctccagcttttagaggcaccgaaaagcaaatacgttattgtggtatgcat
atctattggcgtgtctttaaaggtttggaatggccatttcctactattgatagggaacct
atcctcgaaatgattatagctgcagaaaaggtttacgggcatacctttaatttaattgag
cgagaacaaactgcttattgggcggcttgcgcacaagttcgaattttgggtggtgatttg
attgactgtgtggaagaatttcaaggaattaaagaaggaaatccgctatataaagagtta
gaaccattaattttgaacatgtttaaagaaatgccattaagtggagatgctttatcaaat
gaagtcgattacattttttctttgtttaatattattccacatcaaattgaaacgacagag
cttgtaaaagatacagttggttttttgaaacaaaatcagctaccatcctaccaagcaaca
gaattaatactagatgagtttctaaaaaatttacacactattggtttgaaaaaggataat
cttttattaattgaaagtttaagtagtatccactatcatgcctatttatttaaagctgat
tcaattcgcttttatttttctaaatttgcttataatgagcgtaagtatcatcgtctattt
tacaaaaaattccaaccaattgcggaaagattagcaaaaatacctgaagtagctccaatt
tttgagcaaagtgaattcttatttaatcattatattccatttatcgctccatatatagat
tggagttattatgaaaaaattatcagagtccaaattttaaccgaaaatggtcggtatact
gaaattaaattaggtaaggatatcataaatatcttgcctcatagacttgaaatagtttct
tcttatcaacttgaaccagctcacgaagcagaggttgatttgattgtgacagattgttta
attacaggtatagatactcccgtttttatttgtaaaattcctccaacaatgggagactgg
actcgtttagaacgatatatttcagatataagtatgagagaataa

DBGET integrated database retrieval system