KEGG   Carnobacterium maltaromaticum: BN424_910Help
Entry
BN424_910         CDS       T02342                                 

Gene name
pgm3
Definition
(GenBank) phosphoglycerate mutase family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCO10408
UniProt: K8EF50
Position
967999..968667
Genome map
AA seq 222 aa AA seqDB search
MGKGCTFYFVRHGETYFNRYMKMQGWSNTPLTKDGRFTVIRSGRGLSDIRFDAAYCSDLS
RTKETLEILLEENFTSRNLKIQEMPEFREAFYGSFEGSDVDESWATISKELGYETADEMR
EKATLADRIDGTKAADPLHDAEDFLTFWLRVEKGMLQLIEKHRETDQNILIVAHGNTIRN
LLNGIVPELEMPTSVDNASVSVVNYHDGQYHLERFNDTGHFR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaaaggatgtacattttattttgtcagacatggggaaacttattttaatcgttat
atgaaaatgcaagggtggtcaaatactccgttaacaaaagatggtcgttttactgtgatt
agaagcggcagaggcttatcggatattcgttttgatgctgcttattgtagtgatttaagt
cggacgaaagaaacgttagagattttattagaagaaaatttcacttcacgtaatttaaaa
attcaagaaatgcctgaatttagagaagcattctatggctcttttgaaggttctgatgtg
gacgaaagctgggcaacaattagtaaggaattaggttatgaaacagcagatgagatgcgt
gaaaaagcgactttagcagatcgaattgatgggacaaaagcagctgatcccttacatgat
gcagaagattttttaactttttggttacgtgttgaaaaaggcatgttgcaactgattgaa
aagcatcgtgagacggatcaaaatattttgattgtcgctcatggaaatacgattcggaat
ctgttaaatggaattgtacctgaattagaaatgccgacttctgttgacaatgccagcgtt
tcagtcgtgaattatcatgatggccagtatcacctagagcgctttaatgatacaggacat
tttagatag

DBGET integrated database retrieval system