KEGG   Carnobacterium maltaromaticum: BN424_910Help
Entry
BN424_910         CDS       T02342                                 

Gene name
pgm3
Definition
phosphoglycerate mutase family protein (EC:5.4.2.1)
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cml  Carnobacterium maltaromaticum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cml01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cml01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cml00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:cml00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cml00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
967999..968667
Genome map
AA seq 222 aa AA seqDB search
MGKGCTFYFVRHGETYFNRYMKMQGWSNTPLTKDGRFTVIRSGRGLSDIRFDAAYCSDLS
RTKETLEILLEENFTSRNLKIQEMPEFREAFYGSFEGSDVDESWATISKELGYETADEMR
EKATLADRIDGTKAADPLHDAEDFLTFWLRVEKGMLQLIEKHRETDQNILIVAHGNTIRN
LLNGIVPELEMPTSVDNASVSVVNYHDGQYHLERFNDTGHFR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaaaggatgtacattttattttgtcagacatggggaaacttattttaatcgttat
atgaaaatgcaagggtggtcaaatactccgttaacaaaagatggtcgttttactgtgatt
agaagcggcagaggcttatcggatattcgttttgatgctgcttattgtagtgatttaagt
cggacgaaagaaacgttagagattttattagaagaaaatttcacttcacgtaatttaaaa
attcaagaaatgcctgaatttagagaagcattctatggctcttttgaaggttctgatgtg
gacgaaagctgggcaacaattagtaaggaattaggttatgaaacagcagatgagatgcgt
gaaaaagcgactttagcagatcgaattgatgggacaaaagcagctgatcccttacatgat
gcagaagattttttaactttttggttacgtgttgaaaaaggcatgttgcaactgattgaa
aagcatcgtgagacggatcaaaatattttgattgtcgctcatggaaatacgattcggaat
ctgttaaatggaattgtacctgaattagaaatgccgacttctgttgacaatgccagcgtt
tcagtcgtgaattatcatgatggccagtatcacctagagcgctttaatgatacaggacat
tttagatag

DBGET integrated database retrieval system