KEGG   Carnobacterium maltaromaticum: BN424_910Help
Entry
BN424_910         CDS       T02342                                 

Gene name
pgm3
Definition
(RefSeq) phosphoglycerate mutase family protein (EC:5.4.2.1)
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cml  Carnobacterium maltaromaticum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN424_910 (pgm3)
   01230 Biosynthesis of amino acids
    BN424_910 (pgm3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN424_910 (pgm3)
  Energy metabolism
   00680 Methane metabolism
    BN424_910 (pgm3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN424_910 (pgm3)
Enzymes [BR:cml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     BN424_910 (pgm3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
967999..968667
Genome map
AA seq 222 aa AA seqDB search
MGKGCTFYFVRHGETYFNRYMKMQGWSNTPLTKDGRFTVIRSGRGLSDIRFDAAYCSDLS
RTKETLEILLEENFTSRNLKIQEMPEFREAFYGSFEGSDVDESWATISKELGYETADEMR
EKATLADRIDGTKAADPLHDAEDFLTFWLRVEKGMLQLIEKHRETDQNILIVAHGNTIRN
LLNGIVPELEMPTSVDNASVSVVNYHDGQYHLERFNDTGHFR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaaaggatgtacattttattttgtcagacatggggaaacttattttaatcgttat
atgaaaatgcaagggtggtcaaatactccgttaacaaaagatggtcgttttactgtgatt
agaagcggcagaggcttatcggatattcgttttgatgctgcttattgtagtgatttaagt
cggacgaaagaaacgttagagattttattagaagaaaatttcacttcacgtaatttaaaa
attcaagaaatgcctgaatttagagaagcattctatggctcttttgaaggttctgatgtg
gacgaaagctgggcaacaattagtaaggaattaggttatgaaacagcagatgagatgcgt
gaaaaagcgactttagcagatcgaattgatgggacaaaagcagctgatcccttacatgat
gcagaagattttttaactttttggttacgtgttgaaaaaggcatgttgcaactgattgaa
aagcatcgtgagacggatcaaaatattttgattgtcgctcatggaaatacgattcggaat
ctgttaaatggaattgtacctgaattagaaatgccgacttctgttgacaatgccagcgtt
tcagtcgtgaattatcatgatggccagtatcacctagagcgctttaatgatacaggacat
tttagatag

DBGET integrated database retrieval system