KEGG   Carnobacterium maltaromaticum: BN424_943Help
Entry
BN424_943         CDS       T02342                                 

Definition
(GenBank) putative uncharacterized protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2969
Motif
Other DBs
NCBI-ProteinID: CCO10407
UniProt: K8E2R8
Position
997154..997381
Genome map
AA seq 75 aa AA seqDB search
MARGNKEVKVEVRETERNTEDFVELELFINDEKIGTVQQEGKKNPTVSIKDGKSFVVKTV
DAGINDLIMDYNLHN
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
ttggcgagaggtaataaggaagtaaaagttgaagtacgagaaactgaacgaaatacagaa
gattttgttgagttagaattatttattaatgatgaaaaaattggaactgttcaacaagaa
ggtaaaaaaaatccaactgtgtctataaaagatggcaagagttttgttgttaaaacagtc
gatgcagggattaatgatttaattatggattacaatttacacaactaa

DBGET integrated database retrieval system