KEGG   Carnobacterium maltaromaticum: BN424_944Help
Entry
BN424_944         CDS       T02342                                 

Gene name
yihY
Definition
(GenBank) conserved hypothetical protein
  KO
K07058  membrane protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB SUR7
Motif
Other DBs
NCBI-ProteinID: CCO10445
UniProt: K8E2Y9
Position
997530..998489
Genome map
AA seq 319 aa AA seqDB search
MERVIKSKKSREKIISVFQLAQKNWENANVSSQAAQLAYFVLLSLFPILLVAGNLIPFLP
ISTEEIMPYVQSAVPPDIFKLLQPILDNILHSSSGTAISFGIVTAIWSASSGFNALQQVM
NNVYGTEMRKNFIVARIFSFIIALVMIVVLGSVILIFVFGEQVIRFVQEKLALNMDILSE
FTSIKWVTTILVLLIVFMILYWLVPNVRWGIKYALPGAVFATVGWLLSSQAFSIYVRFQG
GKSIGTGTLSIFIVLMLWLYLIATILLLGGFINVMVYHYLKEIKEPHPDDDQAIPQAKGM
KQRRKLIRIKAENENLMKF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgttataaaatctaaaaagtccagagaaaaaattataagtgtttttcaacta
gcacaaaaaaattgggagaatgctaatgtttcttcccaagcagcacaacttgcctatttt
gtcttattgtcattatttcctatattattagtagcaggtaatttgattccttttttacca
attagtacggaagagatcatgccttatgtgcaatccgcagttccgccagatatttttaaa
ttattgcaacctatattggataatattttgcattcatcaagtggaacagcaatttcattt
gggattgtaacagctatttggtcggcttcaagtggctttaatgctctacaacaagtgatg
aataatgtttacggtacagaaatgcgtaaaaattttattgtggcacgaattttttctttt
attattgcattagtgatgattgttgttctaggttcagtaattttaatttttgtttttggt
gaacaagtcattcgttttgtgcaagaaaaattagccttaaatatggatattctttctgaa
tttacaagtattaaatgggttacaacgattttagtattactgattgtctttatgattctt
tattggttagttccaaatgttcgatgggggattaaatatgctctaccgggcgctgttttt
gcaacagttggttggctgctttcctctcaagctttttctatatatgttcgttttcaagga
ggaaaatcaatcggcacaggaacgcttagtatttttattgttttgatgctctggttgtat
ttaattgccacgatattgctactaggtggctttattaatgtaatggtctatcattattta
aaagaaattaaagaaccacatccagatgatgatcaggcaattcctcaggctaaagggatg
aaacagcgacgtaaattaatacgaattaaagccgaaaatgaaaatctcatgaaattttag

DBGET integrated database retrieval system