KEGG   Carnobacterium maltaromaticum: BN424_947Help
Entry
BN424_947         CDS       T02342                                 

Definition
(GenBank) hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCO10411
UniProt: K8EPK0
Position
1001300..1001419
Genome map
AA seq 39 aa AA seqDB search
MTKSVTSNSPIFLLELPGSTNFLLRLVLMSQLLEKKMKI
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaagcgtcacatcaaattcccctattttcttgctagagctacccggctcaaca
aactttttattaaggctagttcttatgagccaactcctcgagaaaaagatgaaaatttga

DBGET integrated database retrieval system