KEGG   Carnobacterium maltaromaticum: BN424_956Help
Entry
BN424_956         CDS       T02342                                 

Definition
(GenBank) putative membrane protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
cml  Carnobacterium maltaromaticum
Module
cml_M00254  ABC-2 type transport system
Brite
Transporters [BR:cml02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    BN424_956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane_2 ABC2_membrane
Motif
Other DBs
NCBI-ProteinID: CCO10420
UniProt: K8E2X4
Position
1007786..1008535
Genome map
AA seq 249 aa AA seqDB search
MSSSMRKIQTLFMFKLEMILKNLTIMLGPIMAILFVFIFKTVVEVPTPGGTQPESVEFVT
GYILQIGVIFNVTMTGIMAASMPLAEEKEKQTLRVLLSSSVNKVEFLIGSLAPVLVIMTA
INFILIPISGVFVGNMLVYLLITTIVSVITIILGLLIGMSAKNQMSVSLLSMPFMLILMM
IPLLFQLNDLAGKASSFIYTGTLNEIISRLAQNDPNPVSLKNGLVLVAWFIVASGSCLYF
YKKKGLESE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttccatgcgaaaaatacagacactatttatgtttaaattagaaatgattttg
aaaaatttaacgattatgctggggccgattatggcaatcctatttgtttttatctttaaa
acagttgtggaagtacccactccagggggaacacaaccagaatcagtagaatttgttaca
gggtatattttacagataggcgttatatttaatgtgacaatgacgggcattatggcggct
agtatgcctttagcagaagaaaaagaaaagcagacgttacgtgttttgttgagttcatct
gttaataaagtggaatttctgattggaagtttggcaccagtcttagtcattatgacagca
atcaattttattttgattccaattagcggtgtattcgttgggaacatgctagtctatcta
ttaattaccaccatagttagcgtaattacaatcattttaggtttacttatcggtatgagt
gccaaaaatcaaatgtcagtgtcgttattatcaatgccatttatgcttattttgatgatg
attccattactttttcaactaaacgatttagctggtaaagcttctagttttatttataca
ggcacactaaatgaaataattagccgtttggctcaaaatgatcccaatcccgtttcttta
aaaaatggtttggttctcgtagcttggttcatagttgcaagtggaagctgtctttatttt
tataagaaaaaaggcctggaatcagaataa

DBGET integrated database retrieval system