KEGG   Carnobacterium maltaromaticum: BN424_958Help
Entry
BN424_958         CDS       T02342                                 

Definition
hypothetical protein
Orthology
K08234  
glyoxylase I family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1009298..1009678
Genome map
AA seq 126 aa AA seqDB search
MNLQALHHVAIIVSDYQKSKEFYVDLLGFEVIRENYRPERNDHKLDLKFGNSELEIFAMP
NNPKRVSNPEACGLRHLAFKVDAIEEVISELAAKGIDCEPIRIDDYTNEKMTFFFDPDGL
PLELHE
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaagcactacatcatgtggcgattattgtctcagattatcaaaagtcaaaa
gaattttatgttgatttactaggctttgaagtgatcagagagaactaccgtcctgaacgg
aatgatcataaattagatttaaaatttggcaacagcgagcttgaaattttcgcaatgcca
aataatcccaaacgagtttcaaatccagaagcatgtggacttagacatttagcttttaaa
gtcgatgctattgaggaagtcatttctgaattagctgctaaaggaattgactgtgagccg
attcggatcgatgattacacgaatgagaagatgaccttctttttcgatccagatggtttg
ccactagaattacatgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system