KEGG   Carnobacterium maltaromaticum: BN424_965Help
Entry
BN424_965         CDS       T02342                                 

Gene name
sufS
Definition
(GenBank) cysteine desulfurase, SufS subfamily protein
  KO
K11717  
cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
cml  Carnobacterium maltaromaticum
Pathway
Selenocompound metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cml00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    BN424_965 (sufS)
Enzymes [BR:cml01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BN424_965 (sufS)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     BN424_965 (sufS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1014935..1016173
Genome map
AA seq 412 aa AA seqDB search
MILDAEALKKDFPILFQEVNDEPLVYLDNAATSQKPQAVLDALSDYYHFDNANVHRGVHT
LAERATAKYEAAREKVRHLIKASETAEILFTRGTTTSLNWVARSYGEANVTEGDEIVISY
MEHHSNIIPWQQLAKQRKATLKYIDLTPDGQLDMASAKKQITEKTKIVAIAHVSNVLGVV
NPIKELVELAHQVGAVIVVDGAQSVPHMDVDVVALDADFYAFSGHKMLGPTGIGILYGKR
HLLEKMEPIEFGGEMIDFVYQNDSTWKELPWKFEAGTPNIAGAIGLGAAVDYLNQVGLPA
IHQYEQELVAYVLPKLMAIPGITIYGPTDSAIRTGVITFNLEGVHPHDLATAMDMEGVAV
RAGHHCAQPLMNYLKVNSTARASFYFYNTKADADRFIAALLATKEFFSHGAI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgattcttgatgctgaagccttgaagaaagattttccgattctatttcaagaagtcaac
gatgaacctcttgtctatttggataatgccgctacaagtcaaaagcctcaagccgtttta
gatgctctttcagactactatcattttgataatgccaacgttcatcgcggggtgcatacc
ctagcagaacgcgcaacagcaaaatacgaagccgccagagaaaaagtgcgccatttaatc
aaagctagcgaaacagctgagatactctttacccggggcacaaccaccagtctaaactgg
gttgctagaagttacggagaagcaaacgtaacagaaggcgatgaaattgtgatttcctat
atggaacatcactcaaacatcattccttggcaacaattagccaaacaaagaaaagcgaca
ctaaaatatatcgacttaaccccagacggacagttagatatggcaagtgccaaaaaacag
attaccgaaaaaacgaaaatcgtagccattgctcacgtatccaacgttttaggcgtagtt
aacccaatcaaagaattagtagaactagcacatcaagtcggagccgttatcgttgttgat
ggagcacaatctgttcctcatatggacgttgacgtcgtagccttagacgctgatttctat
gcctttagcggacataaaatgctgggaccaaccggaatcgggattttatacggcaaacgc
cacctattagaaaaaatggaaccaattgaatttggcggtgagatgattgatttcgtctac
caaaacgacagcacatggaaagaactgccttggaaatttgaagcaggcactccgaatatt
gctggcgccattggattaggagcagctgttgactatttaaatcaagttggtttacctgcg
attcatcagtatgaacaagaattggtggcctatgttttgcctaaattaatggcaatccct
ggcattactatctatggaccaactgattcagccattcgcacaggagttattaccttcaac
ttagaaggtgtgcatcctcacgatttagcaacagcaatggatatggaaggagttgctgtt
cgagccggacatcattgtgcgcaacctttaatgaactatttaaaggtcaactcgacagca
agagctagtttttatttctataataccaaagccgatgcggaccgcttcattgcagccctt
ttggcgacgaaggagtttttcagtcatggcgctatctag

DBGET integrated database retrieval system