KEGG   Carnobacterium maltaromaticum: BN424_968Help
Entry
BN424_968         CDS       T02342                                 

Definition
(GenBank) hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCO10470
UniProt: K8E304
Position
1018972..1019139
Genome map
AA seq 55 aa AA seqDB search
MRLNEQIEIERKNKGLSKKKLVQIIEESIGLTFKWKQLNVGNQELLVLIPKFWHF
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgaggttaaatgaacaaattgaaattgagagaaaaaacaaagggttatcaaagaaaaag
ttagtacaaattattgaggaatctattggattaacatttaagtggaaacaattaaacgtt
gggaatcaggaacttctagtattgatcccaaagttttggcatttctaa

DBGET integrated database retrieval system