KEGG   Cucurbita moschata (crookneck pumpkin): 111456400Help
Entry
111456400         CDS       T05248                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00052  Galactose metabolism
cmos00500  Starch and sucrose metabolism
cmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmos00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    111456400
   00500 Starch and sucrose metabolism
    111456400
Enzymes [BR:cmos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111456400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 111456400
NCBI-ProteinID: XP_022954013
Position
Unknown
AA seq 573 aa AA seqDB search
MASSSLCFISFLCFLLCHGALKLQASHHVYTPQPSRLLLHHHEQPYRTSCHFQPPKNWIN
DPNGPMIYKGIYHLFYQYNPKGAVWGNIVWAHSTSTDLINWKPHDYAIYPSQPSDINGCW
SGSATILPGDKPAILYTGINPKNQQVQNLAVPKNLSDPYLREWVKSPKNPLMAPTPQNHI
NSSSFRDPTTAWLGPDGEWRVIIGSKVDDRGLAIMFRSKDFVKWDQVDHPLHYADGMGMW
ECPDFFPVAKNGRAGVDTSVSGQHVKHVLKVSLDDTKHDQYTVGTYDLKKDIYVPDKGSI
QDYSGLRYDYGKYYASKTFFDGQKKRRVLWGWVNESSSVDDDIKKGWSGVQAIPRTVWLD
ASGKQLIQWPIAEIQKLRKDKIKLTNKVLEKGSIIAVKGVTAAQADVDVSFKVKSFNKAH
LLKAEWKDPQLVCSQMGAAAKGGVGPFGLLVLASNNLEEYTSVFFRIFKRQDKYVVLMCS
DQSRSSLNADNDKTMYGAFLDVDPVRKNVSLRSLIDHSIVESFGSKGKACITARVYPRLA
IGDKAGLYAFNNGTESVTITKLRAWSLKKAQII
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcctctctctgcttcatctctttcctctgtttcttgctctgccatggagct
ttgaagctgcaagcttcccaccatgtttacacacctcaaccttctcgccttcttcttcat
catcatgaacagccttacagaacttcctgccattttcagcctcccaagaactggatcaac
gatccaaatgggccaatgatatacaaggggatttatcatctgttttaccaatacaatcct
aaaggagctgtgtggggtaacattgtgtgggcccactccacatcaacggacctgatcaat
tggaaaccccatgattatgccatctacccatctcagccctccgatataaacggctgctgg
tcgggatccgccaccattctccctggtgacaaaccggccattctgtacacaggaattaac
cctaaaaaccaacaagttcaaaacttggctgtccctaagaatctgtctgacccatatctt
agagaatgggtgaaatccccaaagaatcctctcatggctcccaccccacaaaaccacatc
aactctagctccttccgcgaccccaccaccgcctggctcggccccgatggcgaatggcgg
gttatcatcgggagcaaagttgatgaccgtggacttgccattatgttccgaagcaaagat
tttgttaagtgggatcaggttgatcatccacttcattatgccgatggcatgggaatgtgg
gagtgtccagatttcttccctgtggcaaagaatggtcgggcgggcgttgacacgagtgtg
agtggacaacacgtgaaacacgtgttgaaggtgagcttggatgatactaagcatgatcag
tacacggtcggaacatatgatttgaagaaagatatttatgttccggataaaggatcaatc
caagactactccggattgagatatgattatggaaagtattacgcttcaaagacattcttc
gacggccagaagaagaggagagttttgtggggttgggtgaatgaatcctccagcgttgat
gatgatatcaagaagggatggtctggcgtccaggcaattccaaggacagtttggcttgat
gcatctggaaagcaactaattcaatggccaattgcggaaattcaaaagcttcgaaaggac
aaaattaaattgacaaacaaagtattggagaaaggatcaataattgcagtaaaaggtgta
acagcggcacaggccgatgttgatgtttcattcaaagtgaaaagcttcaacaaagctcat
ctgctgaaggctgaatggaaagacccacaattggtttgtagccaaatgggagcagctgcc
aagggtggagttggtccatttgggcttctagttttggcttccaacaacttggaagagtac
acttccgtgttctttaggatattcaaacgacaagacaagtatgtcgtgcttatgtgtagc
gaccaaagcaggtcttcattgaacgcagataatgacaagacaatgtatggagcattctta
gatgtagacccagttcgtaaaaacgtttcgttgagaagtctgattgatcactcaattgtg
gaaagctttggatcgaaagggaaggcttgcatcacagcgagagtgtatccaaggttggcg
attggagacaaagctggtctctatgcttttaacaatggaacagagagtgtaaccatcaca
aaactccgtgcttggagcctgaaaaaagctcaaataatttaa

DBGET integrated database retrieval system