KEGG   Chamaesiphon minutus: Cha6605_0053Help
Entry
Cha6605_0053      CDS       T02414                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00260  Glycine, serine and threonine metabolism
cmp00750  Vitamin B6 metabolism
cmp01100  Metabolic pathways
cmp01110  Biosynthesis of secondary metabolites
cmp01120  Microbial metabolism in diverse environments
cmp01230  Biosynthesis of amino acids
Module
cmp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cha6605_0053
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cha6605_0053
Enzymes [BR:cmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cha6605_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFY91361
UniProt: K9UAC2
Position
61468..62571
Genome map
AA seq 367 aa AA seqDB search
MSLDTHIEVNSGISTNRGWPGLIENYRAYLPVSATTPVVTLHEGNTPLIPVPTIAAEIGR
GVKVYIKYDGLNPTGSFKDRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYAVRGGMRA
YVLIPDGYVALGKLAQALLYGAEVLAIKGNFDDALDIVRQMAENYPITLVNSVNPYRLEG
QKTAAFELVDALGDAPDWLCIPVGNGGNITAYWMGFNQYYQHGKSQKLPQMMGFQASGAA
PLVSGIRVKSPETLATAIRIGNPANWDKAVAAKNDSNGEFNAVTDDEIIAAYRWLGSREG
IFCEPASAASVAGLLKVKDRVPSNATVVCVLTGNGLKDPDTAIANKINPFQQGIAANMDA
VAAAMGF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagatacccatattgaagtcaattccggaatcagtaccaaccgtggttggccg
ggattaattgaaaactatcgagcgtatctacccgtgagtgcgactaccccagtagttact
ctgcatgagggtaacacaccgttgattcccgtgcccacgatcgctgccgaaatcggtcgg
ggtgtaaaagtatatattaaatatgacggtctaaacccgacaggtagcttcaaagaccga
gggatgactatggccattaccaaagctaaagaagcaggtgctaaggcggtaatttgtgcc
agtacgggcaatacttcggcggcggcagcagcttatgccgtgcgcggtggaatgcgcgct
tatgtgttgattcccgatggctatgtcgcgctggggaaattggcccaagccttgctttac
ggggctgaagtgttggcgattaaaggtaactttgatgatgcgctcgatatcgtgcggcag
atggccgaaaattatccgattacgctagtaaattctgtcaatccctatcggctcgaaggc
caaaaaacagccgcattcgagcttgtcgatgctctgggtgacgctccagattggttgtgt
attccagtaggcaatggtggtaatatcacggcttattggatgggtttcaatcaatattac
cagcatgggaaatcccaaaaactccctcagatgatgggttttcaagcatcaggtgctgca
ccgctagtcagtggcattcgcgtcaaaagtcccgaaactctcgccacggcaatccgcatc
ggcaatccagcaaactgggataaagcagtagcagctaaaaatgacagcaatggcgaattt
aatgctgttacggacgacgaaattattgctgcttatcggtggttgggtagccgcgaaggg
atcttctgcgaacctgcgagtgcggcttcggtggctggcttgctcaaagtcaaagatcgc
gtaccgagcaatgctacggtagtatgtgtcttaactggcaatggtctcaaagaccccgat
acagcgatcgctaacaagatcaatcctttccaacagggtattgccgccaatatggatgct
gttgccgccgccatgggattttaa

DBGET integrated database retrieval system