KEGG   Chamaesiphon minutus: Cha6605_0287Help
Entry
Cha6605_0287      CDS       T02414                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cmp  Chamaesiphon minutus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cha6605_0287
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cha6605_0287
Enzymes [BR:cmp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cha6605_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312588..313922
Genome map
AA seq 444 aa AA seqDB search
MLATEKSVIHIWGQHPLSGEVKISGAKNSALVVMAGALLCSTGCRLQNIPGLVDVDKMCQ
IIEALGVKIERNGEVLDFDTTGFNCHTPPFELVSKLRAAFFAIGPILARLGVAKVPLPGG
CSIGARPVELHVRGLQAMGAHVEIEHGIVNAFVTGSNKRLQGAKIYLDYPSVGATETLMM
AATLAEGETILENAAKEPEVVDLANFCIAMGAQIFGAGTDRITIVGVDKLHEADYSIIAD
RVEAATFLVAGAITNSELSLYPVIPDHLTAAVAKLDQIGAKVVIDAPDRMRVIPTGTLKG
TDIETLPYPAFPTDMQAQFMAMLAVSEGSSVITETVFENRLQHVAELKRMGANIRVKGNH
AIVEGVPLLSGATVTATDLRASAALVLAGLAAQGKTTIQDLHHLDRGYDCLEAKMRNLGA
KIERVRVNAEGEIVYRYADEVVRV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttagcaacagaaaagtctgtgattcacatctggggtcaacacccattgtctggagaa
gtcaaaatcagtggtgcgaagaattccgccttggttgtcatggctggtgccttgctgtgc
tcgactggatgtcggctccaaaatatccccggactggtcgatgtcgataagatgtgccag
attattgaagccttgggagtcaagatcgagcgtaatggcgaagttttggatttcgatacc
actggattcaactgtcatacaccgccctttgaattggtttccaagttgcgggcggctttt
tttgcgatcgggccgattttagcgcggttaggggttgctaaggtcccattaccaggcggc
tgctcgatcggcgcgcgtccggtagaattacacgttcgcggcttgcaagcgatgggcgcg
catgtcgaaatcgagcatggaattgtcaatgcttttgtgactggctcgaacaaacgcctg
caaggggcgaagatatatctggactacccaagtgtcggcgcgaccgaaacattgatgatg
gcggcgacgctagccgagggtgagacgattttagagaacgcagctaaggaaccggaagtt
gtcgatttagccaatttctgtattgctatgggcgcgcagattttcggggcgggtacagat
cggattacgatcgtcggcgtcgataagctacacgaggccgattatagtatcattgccgat
cgcgtcgaagcagcgacatttttggtggctggcgcgattaccaattcggagttgagtctg
tatccagtcatccccgatcatctcaccgccgcagtcgcgaagttagatcaaatcggcgcg
aaagtagtcatagatgccccagatcggatgcgggtaattcccacgggcacgctcaaaggg
acggatatcgagaccctgccttatccagcttttccgaccgatatgcaagcccagtttatg
gccatgctcgccgtgagtgaaggtagtagtgtcattaccgaaaccgtatttgaaaatcgg
ctccaacatgtggccgaactcaaacggatgggtgccaatattagggtcaaaggcaatcat
gcgatcgtcgaaggcgtaccgttattatcgggtgcgactgtcaccgcaacggatttgcgc
gcttcggctgcgctggtactagctggtttggccgctcaaggcaaaaccacgattcaagac
ctccatcacctcgatcgcggttacgattgtctcgaagccaaaatgcgcaatctcggagcc
aaaatcgaacgggtacgggtcaatgctgagggtgaaattgtctatcgctatgcagatgaa
gtcgtgcgggtgtaa

DBGET integrated database retrieval system