KEGG   Chamaesiphon minutus: Cha6605_0287Help
Entry
Cha6605_0287      CDS       T02414                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cmp  Chamaesiphon minutus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cmp00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cmp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312588..313922
Genome map
AA seq 444 aa AA seqDB search
MLATEKSVIHIWGQHPLSGEVKISGAKNSALVVMAGALLCSTGCRLQNIPGLVDVDKMCQ
IIEALGVKIERNGEVLDFDTTGFNCHTPPFELVSKLRAAFFAIGPILARLGVAKVPLPGG
CSIGARPVELHVRGLQAMGAHVEIEHGIVNAFVTGSNKRLQGAKIYLDYPSVGATETLMM
AATLAEGETILENAAKEPEVVDLANFCIAMGAQIFGAGTDRITIVGVDKLHEADYSIIAD
RVEAATFLVAGAITNSELSLYPVIPDHLTAAVAKLDQIGAKVVIDAPDRMRVIPTGTLKG
TDIETLPYPAFPTDMQAQFMAMLAVSEGSSVITETVFENRLQHVAELKRMGANIRVKGNH
AIVEGVPLLSGATVTATDLRASAALVLAGLAAQGKTTIQDLHHLDRGYDCLEAKMRNLGA
KIERVRVNAEGEIVYRYADEVVRV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttagcaacagaaaagtctgtgattcacatctggggtcaacacccattgtctggagaa
gtcaaaatcagtggtgcgaagaattccgccttggttgtcatggctggtgccttgctgtgc
tcgactggatgtcggctccaaaatatccccggactggtcgatgtcgataagatgtgccag
attattgaagccttgggagtcaagatcgagcgtaatggcgaagttttggatttcgatacc
actggattcaactgtcatacaccgccctttgaattggtttccaagttgcgggcggctttt
tttgcgatcgggccgattttagcgcggttaggggttgctaaggtcccattaccaggcggc
tgctcgatcggcgcgcgtccggtagaattacacgttcgcggcttgcaagcgatgggcgcg
catgtcgaaatcgagcatggaattgtcaatgcttttgtgactggctcgaacaaacgcctg
caaggggcgaagatatatctggactacccaagtgtcggcgcgaccgaaacattgatgatg
gcggcgacgctagccgagggtgagacgattttagagaacgcagctaaggaaccggaagtt
gtcgatttagccaatttctgtattgctatgggcgcgcagattttcggggcgggtacagat
cggattacgatcgtcggcgtcgataagctacacgaggccgattatagtatcattgccgat
cgcgtcgaagcagcgacatttttggtggctggcgcgattaccaattcggagttgagtctg
tatccagtcatccccgatcatctcaccgccgcagtcgcgaagttagatcaaatcggcgcg
aaagtagtcatagatgccccagatcggatgcgggtaattcccacgggcacgctcaaaggg
acggatatcgagaccctgccttatccagcttttccgaccgatatgcaagcccagtttatg
gccatgctcgccgtgagtgaaggtagtagtgtcattaccgaaaccgtatttgaaaatcgg
ctccaacatgtggccgaactcaaacggatgggtgccaatattagggtcaaaggcaatcat
gcgatcgtcgaaggcgtaccgttattatcgggtgcgactgtcaccgcaacggatttgcgc
gcttcggctgcgctggtactagctggtttggccgctcaaggcaaaaccacgattcaagac
ctccatcacctcgatcgcggttacgattgtctcgaagccaaaatgcgcaatctcggagcc
aaaatcgaacgggtacgggtcaatgctgagggtgaaattgtctatcgctatgcagatgaa
gtcgtgcgggtgtaa

DBGET integrated database retrieval system