KEGG   Chamaesiphon minutus: Cha6605_0700Help
Entry
Cha6605_0700      CDS       T02414                                 

Definition
magnesium chelatase, H subunit
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cmp  Chamaesiphon minutus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cha6605_0700
Enzymes [BR:cmp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cha6605_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
748353..752357
Genome map
AA seq 1334 aa AA seqDB search
MFTNVKSTIRHITPDDVRGRQLLKVVYVVLEPQYQSALSAAVKAINDHNPKVAIEISGYL
LEELRDPENYAGLERDIQTANIFIASLIFIEDLAEKVVAAVAPHRDNLDVAVVFPSMPAV
MRLSKMGSFSLAQLGQSKSAIGEFMKKRKANAGAGSFQDGMLKLLNTLPNILKYLPMEKA
QDARNFMLSFQYWLGGTPENLENFLLMLADRYVLKEDDTLNSATSAGEIKYQDPVTFPDM
GIWHPMAPQMFEDVKEYLNWYNSRRDISDDLKDPLAPCIGLVLQRTHIVTGDAAHYVAML
QEFEAMGARVIPMFASGLDFSKPLEAFFFDPIGKNNAIVDAVVSLTGFALVGGPARQDHP
KAIDVLKRLNRPYMVALPLVFQTTEEWEESDLGLHPIQVALQIAIPELDGAIEPIILSGR
DGSTGRAIALQDRIEAIAGRAMKWANLRRKPKITKKVAITVFSFPPDKGNVGTAAYLDVF
GSIYEVLKSMRDNGYDVRDIPASPKELLEEVIHDAQAQYNSPELNVAYRMSVPEYEALTP
YSEKLHESWGPPPGNLNSDGQNLVIYGKHFGNIFIGVQPTFGYEGDPMRLLFSRSASPHH
GFAAYYTYLEKVWEADAVLHFGTHGSLEFMPGKQMGMSNDCFPDSLIGNIPNLYYYAANN
PSEATIAKRRSYAETISYLTPPAENAGLYRGLQELGELVGSYQALRDSGRGVQIVNTIMD
KARICNLDKDVELPDIDAGTMDIETRDNIVGSVYRRLMEIESRLLPCGLHVVGKPPTAEE
AIATLVNIASLDREEEGIKGLPRIIAESIGRNLEQIYQSNDRGILEDVQLLQDMTLAVRE
AVAAMVKAQINEEGRVSFVAKLNIFNMGKKAAWVESLYASGYKNVNLEEIKTQFDYLEFC
LTQVCADNELGALLQGLGGEYILPGPGGDPIRNPDVLPTGKNMHALDPQSIPTEAAVKSA
KVVVDRLLDRQMRENGGKYPETIACVLWGTDNIKTYGESLAQIMWMVGVKPVPDALGRVN
KLILIPLEELGRPRVDVVINCSGVFRDLFINQMNLLDQAVKMAAEADEPLEMNFIRKHAL
VQAEEMGINLRQAATRVFSNASGSYSSNVNLAIENSTWDNEAELQEMYLGRKSFAFNSDN
PGVMDNAREIFETTLKTAEVTFQNLDSSEISLTDVSHYYDSDPTKIVAKLRDDGKMPSSF
IADTTTANAQVRSLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTSGWSATA
GAVDNWVYEETNDTFIKDKEMCKRLMDLNPNSFRKIVSTLLEVNGRGYWETSEENLDMLR
DLYQEVEDRIEGVE
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaacgtcaagtccaccattagacatataactcccgacgatgtgcggggcaga
cagttattgaaggtggtctatgttgtgttagagccacagtaccagagcgcgttgtctgct
gctgtgaaagccattaacgaccacaaccccaaagtcgcgatcgaaattagtggctatctc
ctagaggaactgcgcgatcccgaaaattatgccggacttgagcgcgatatccaaactgcg
aatatcttcatcgcttcactgattttcattgaagacttagcagaaaaagttgtcgccgcc
gttgccccccatcgggataatttagatgtcgcggtagtctttccctcaatgcctgctgtc
atgcggttgagcaaaatgggtagcttctcgttagcacaattgggtcaatctaaaagtgcg
atcggggagttcatgaaaaagcgcaaagcaaatgctggcgcgggtagcttccaagatgga
atgctcaagttattgaacactctacccaatatcctcaagtacctgccgatggaaaaagcg
caggatgctcgtaactttatgttgagcttccagtattggttaggcggtacgccagagaac
ttggaaaacttcttgttgatgttggccgatcgatatgtcttaaaagaagatgatacgctc
aattcggcaacttccgcaggggaaattaaatatcaagatcctgtcactttcccagatatg
gggatttggcacccgatggcaccgcagatgtttgaggatgttaaggaatatctgaattgg
tacaacagccgtcgcgatatttccgacgatcttaaagatccattggctccctgtatcggt
ttggtattgcaacggactcatatcgtcactggcgacgcggcgcattatgtcgccatgctc
caagaatttgaagcgatgggtgcgcgagtcatcccgatgtttgccagcggtttggacttc
tccaagcctctagaagccttcttcttcgacccgatcggcaaaaacaacgcgatcgtcgat
gcagtggtgtccctgactggatttgccctcgttggtggcccagcgcgacaggatcatccc
aaggcaattgacgtgctaaaacggttgaatcgtccttatatggtggcgttaccgttggtc
ttccaaactacggaagagtgggaagaaagcgacttaggcttgcacccgattcaggtagca
ttacagattgcgattcctgaattagatggtgcgatcgagcctattattctatcaggtcgc
gatggttcgaccggacgcgcgatcgctttgcaagatcggatcgaagcgattgccggacgc
gcgatgaaatgggcaaacctgcgtcgcaagccaaaaatcactaagaaagttgcgattacg
gtctttagtttcccaccagacaaagggaacgtcggtaccgccgcatatttagacgtattt
ggttcgatctacgaagtcctcaaatccatgcgggataatggctatgatgtccgagatatc
cccgcatcgcccaaggaattactcgaagaggtgattcacgacgcgcaagcacaatataat
agccccgaattgaatgtggcttatcggatgtcagtgccagaatacgaagcactcacacct
tattctgagaaacttcacgaaagctgggggccaccaccaggtaaccttaatagcgacggc
caaaacctggttatttacggcaaacatttcgggaatatcttcatcggcgttcagcctacc
ttcggttatgaaggcgacccgatgcggttgttattctcccgttccgccagtccccaccac
ggttttgcggcttactatacttacctcgaaaaagtctgggaagcggatgccgtcctccac
tttggtacccacggttcgctagaattcatgccaggaaaacaaatgggaatgtccaacgac
tgcttccccgatagtttgatcggtaatattcccaacctttattactacgccgctaataat
cctagcgaggcgacgattgccaaacgtcgttcctacgccgaaactatctcctacctgact
ccccccgccgaaaatgctggattatatcgcggcttacaagaactcggcgaactcgtcggc
tcttaccaagctctacgcgatagtggtcgcggcgtgcaaatcgtgaatacgattatggat
aaagcgcggatttgcaacctcgataaagatgtcgaattacccgacatcgatgcaggcaca
atggacatcgaaacccgcgataatatcgtcggttccgtctatcgccgcctgatggaaatc
gaatcccgcctcctcccttgtggcttgcatgtcgtcggtaaaccacccacagccgaagaa
gccatcgcgactctagtaaatatagcgtcactcgatcgcgaagaagaaggaattaaagga
ttaccacggattatcgccgaaagtatcggacggaatttagaacaaatctatcagagtaac
gatcgcggtatcctcgaagatgtccaactattgcaagatatgaccctcgccgtccgcgaa
gccgtcgccgcaatggttaaagctcaaatcaacgaagaaggacgagtttccttcgtcgcc
aagttgaacatcttcaacatgggcaaaaaagccgcctgggtcgaatccctctacgcctcc
ggttacaaaaacgttaacctcgaagaaatcaaaacccaattcgactacctcgaattttgc
ctcacccaagtctgtgccgacaacgaactcggcgcactcctccaaggcttaggcggagaa
tatatcttaccagggccaggtggcgacccgattcgcaatcccgatgtcttacccacaggt
aagaacatgcacgccttagatcctcaatccatccccaccgaagccgcagttaaatctgcc
aaagtagttgtggatcggttactcgatcggcaaatgcgggaaaatggtggtaaatatccc
gaaactatcgcttgcgttctctggggtacagacaacatcaaaacctacggcgaatccctc
gcccaaatcatgtggatggtcggcgttaaacccgtccctgacgcattaggccgcgtcaac
aaactgatcctcatccccctcgaagaactcggtcgtccccgcgtcgatgtggtaatcaac
tgttccggtgtcttccgcgacctgttcatcaaccagatgaacctactcgaccaagccgtg
aaaatggcagccgaagccgatgaacccttagaaatgaacttcatccgcaaacacgcccta
gttcaagccgaagaaatgggaatcaacctgcgtcaagccgccacccgcgtcttctccaac
gcctccggttcctactcttctaacgtcaacctcgcgattgaaaatagcacctgggataac
gaagccgaacttcaggaaatgtacctcggacgcaaatccttcgccttcaactccgacaat
cctggcgtaatggataacgctcgcgagatctttgaaaccaccctcaaaaccgccgaagtt
accttccaaaacctcgattcctcggaaatcagtctgaccgacgtatcccactactacgac
tcagaccccaccaaaattgtcgccaaactgcgggacgacggcaaaatgccttcttcgttc
atcgccgataccaccaccgctaacgctcaagttcgcagcctctccgagactgtccgctta
gatgcccgtaccaagctactcaatcccaaatggtatgagggaatgctctcccacggctat
gaaggcgtgcgcgaactctcgaaacggttggtgaatactagcggttggagtgccaccgcc
ggagcggtagataattgggtgtatgaggaaaccaatgacacgtttatcaaggataaggag
atgtgtaagcggttgatggatctcaatcctaattcgttccgcaagattgtttcgacgcta
ttggaagtaaatggacgcggttattgggaaaccagcgaagaaaatctcgatatgctccgc
gacctttaccaggaggtcgaagaccggattgagggtgttgagtag

DBGET integrated database retrieval system