KEGG   Chamaesiphon minutus: Cha6605_0890Help
Entry
Cha6605_0890      CDS       T02414                                 

Definition
glycosyl hydrolase family 9
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cmp  Chamaesiphon minutus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cha6605_0890
Enzymes [BR:cmp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cha6605_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(977080..978798)
Genome map
AA seq 572 aa AA seqDB search
MTRSHRLLIILISAFFLVMAGGNLARWHATESAKIVINQVGYLPNSPKVAFLVNSGNTQR
QIELINTVNRQTVQVITPSQPIRDRDSNDRLQTIDFSQIEQTGNYFLRAGSIESYPFTIA
SDVYQKPVIKMLRSYYLQRCGVEIGDPVTGIRHAPCHLRDGAIAHKDAMNSAGKVISATG
GWHDAGDYGKYVSTTAITVGRLLSLYENEPKAFPDRQLTIPESGNGIPDLLDEMRVGLDW
MLSMQRSDGAIYRKLSGKKWPPIVAPDRDTQPRFIYGISTPETAKFAAAMAIAARVYAPL
QPQQSTLYLKAARRAWDYLQTQPTMKVDWVDGDDSGSGKYLTSEIDTEPSLKIDTDDRLW
AAAELFITTKESQFDRYFLQHLPSDYTLFEWKDPSALGMVNYLSESATSPASEIKLKIAQ
QILNRADALVKKVSTSGYRLANQRFIWGSNKMTATEGLTLILAYRMTDGTAYRQAAIDQI
DYLLGRNPFNQTFVTGIGTHPVRHVNHIFARARKISIPGLLVGGANNGAQDGIAPKNRGL
LSYVDDEKSYATNEYAIDYNAELIALMSMVDR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacaagatctcatcgtctattaattatcctcatcagtgcatttttcctggtaatggct
ggtggcaatttggctcgatggcacgccaccgaatcagctaaaatcgtcatcaatcaagta
ggttatttacccaatagccccaaagttgcctttctagtcaacagtggcaatacacagcga
caaattgagttgataaatactgtcaatcgacagacggtgcaagtcattactcccagtcag
ccaattcgcgatcgagatagtaacgatcgattacaaactattgactttagccagatcgaa
caaactggtaattatttcctgcgagctggatcgatcgagtcttatccgtttacgatcgcg
tctgatgtttatcagaagccagtaattaagatgctgcgctcctattatcttcaacgctgt
ggagtcgagatcggcgatccggttacaggcattcgccatgcgccctgtcatcttcgtgat
ggtgccatcgcccacaaagatgctatgaattcagccgggaaggtaatttcagccacaggc
ggctggcacgacgcgggggattatggcaaatatgtcagcaccaccgccattaccgtaggc
agactattgagcctatatgagaatgagcctaaagcatttcccgatcgccaattaactatt
cccgaaagcggtaacggtatccccgacttactcgatgaaatgcgggtgggattggattgg
atgctgtccatgcagcgatcggatggggcgatttatcgtaaactatctggtaaaaagtgg
ccgccaattgtcgcaccagatcgagatactcaaccccgctttatctatggtatttctacc
ccagagacggcgaaatttgccgcagcaatggcgatcgctgcacgggtatatgctcctctc
caaccccaacaatctaccctctatctgaaggcagctcgacgggcatgggattatttacaa
acccaaccaaccatgaaagtagattgggtagatggtgatgatagcggttcgggtaaatat
cttacttcagaaatcgataccgaaccgagcctaaaaatcgatacagacgatcgattatgg
gcagcagcagaactatttattacgaccaaagaaagccaattcgatcgctattttcttcag
cacttacccagtgactatactctatttgagtggaaagatccgtccgcgctaggaatggtg
aactatctgagtgaaagtgcaacttccccagccagcgagattaaactaaagatcgcccag
caaatcctcaaccgagcggatgcacttgtcaaaaaagtctcaacaagtggctatcgtcta
gcaaatcagcggtttatctggggatcgaacaagatgacggctacagaggggctaacgctc
atattagcttatcgcatgaccgatgggactgcctaccgccaagccgcgatcgaccaaatt
gattatttactcgggcgcaacccttttaaccagacatttgtgactggcatcggtacccat
ccggtacggcatgtcaatcatatctttgcccgcgctcgtaaaatctcaattcctggttta
ttggtaggtggtgctaataatggtgcccaagatgggatcgcgcctaaaaatcgggggcta
ctgagctatgtggatgatgaaaaatcctatgccacgaatgaatatgccatagattacaac
gccgagctaattgcgctgatgagcatggtagatcggtag

DBGET integrated database retrieval system