KEGG   Chamaesiphon minutus: Cha6605_1627Help
Entry
Cha6605_1627      CDS       T02414                                 

Definition
helicase, putative, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cmp  Chamaesiphon minutus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cmp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1699454..1701706)
Genome map
AA seq 750 aa AA seqDB search
MSTYQTNTSGDSSVTPQVSLTGVVERITFHSEESGYTVARLQSPRVRELTTIVGNFANIQ
AGQTLQLQGTWKEHLQYGQQFQVIKYSETKPATLTGIEKYLGSGLIKGVGPVTAKRIVAH
FALDTLEIIEQDSDRLIEVPGIGKKRVKMIQRAWVEQKAIKEVMLFLQTHGVSTTYAVKI
FKQYGEKSIAIVTNNPYQLSEDIFGIGFLTADLIARNLGVDPASTFRYRAGIKHVLGEAA
EDGHCFLPQPELLTAATTKLTTQEHTSTADAVLEVLRTMGVEQELILETVEDVPLYFQPS
FFYTEQNLAISILKLLERPQTVDLPRVRNWIERFTQSHKITLSPEQQQAVEMAATQRVMI
LTGGPGCGKTFCTRTIVALWKAMGKKIALAAPTGRAAQRLSEMAGIEAKTIHRLLEFDPA
TRGFKRGVDEPLPHDAIVVDEASMLDLFLAHSLIKAVRTDAHLLIVGDIDQLPSVGPGSV
LGDLIKSSRIPVVRLTQVFRQAQSSGIIRAAHQINRGQYPTLETISDAPVSDCLWHSGGF
EPEHGVQAICELIRDFVPSLGFDPVTDVQVLCPMTRGIVGTRNLNQVLQQLLNPPALEKP
QINRGGDMLRVGDRVIQLKNDYEREVFNGDLGVVGSIDSTEHEVMIQFDNREVIYDYADL
NELGLAWSISIHKSQGSEYPVVILPLYMQHYLLLSRNLVYTGLTRAKKLAIVVGSNKAIG
LAVRQNQVGKRYTRLPARLGGNTSSTIHQS
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
gtgtctacttatcagacaaatacatcaggcgattcatcagttacaccccaggtttctttg
actggagtggtcgaacggattacctttcattctgaagaaagcggctacactgtcgctcgc
ctccaatcgccccgcgttcgcgaattaaccacgatcgttggtaacttcgcgaatatccaa
gcaggacaaaccctccagctccagggcacatggaaagagcatcttcaatacggtcaacag
tttcaagttatcaaatatagcgaaaccaaacccgccacactgacaggaattgagaagtat
ttgggtagcggtttgattaagggagtcggccccgtcaccgccaaacggattgtggcgcat
ttcgcgctggatactttagaaattatcgaacaggatagcgatcgactaatcgaagttcca
ggcatcggtaaaaagcgcgtcaagatgattcaacgcgcttgggtggagcaaaaggcgatt
aaggaggtgatgctgttccttcagactcatggagtttcgacgacttatgcggtgaaaatc
ttcaaacagtatggcgaaaaatcgatcgcaatcgtcacgaataatccttatcaactgtca
gaagatatctttgggattggcttcctcacagccgatctcatcgctcgaaatttaggtgta
gatcccgcctctacttttcgctatcgagcaggcatcaaacacgttctgggagaagccgcc
gaagatggtcattgcttcctaccccagccagaattattaacagcagcgacgactaaactg
acaacgcaagaacacacatcaaccgcagatgcggtgttagaagtgttgaggacaatggga
gtggaacaggagctaatcctggaaacagtggaagatgtgcccttatatttccaacccagt
ttcttctacaccgaacagaatttagccatttcgatcctcaagctactagaacgaccccaa
acagtcgatttaccccgcgtccgcaattggatcgaacgctttactcaaagccacaaaatt
acgctctcacccgaacaacagcaagcggtggagatggcggcgacacaacgggtaatgatt
ctcactggtggcccaggttgtggtaaaaccttctgtacccgcaccatcgtcgcgctgtgg
aaggcaatgggtaagaaaattgcactcgctgcaccgacgggaagagccgctcagaggctg
tcagaaatggcgggaatcgaggctaaaaccattcaccgtctattagagttcgatccggcg
acgagagggtttaaacggggtgtcgatgaaccattaccccacgatgcgattgtcgttgat
gaggcttcgatgctggatctatttctggcgcattcgctgattaaggcggttcggactgat
gcccacttactgattgtgggagatatcgaccaattgccatcagtcggcccaggtagcgtg
ttgggcgatctgattaaatcgagtcggattccagttgtcagactcactcaggtattccgt
caagcccaatcgagtgggattattcgcgctgctcaccagatcaatcgggggcaatatcct
actctggaaacgatttctgatgcgcctgtgtcggattgtctgtggcatagcggtggattc
gagccggaacatggggtgcaagcgatttgcgagttgattcgagatttcgtgcctagtttg
gggttcgatccggttacggatgttcaggtattgtgtccgatgaccagagggatagtggga
acgcgcaatttgaatcaggtcttgcagcagttactcaatccgcctgcgctggagaagccg
caaattaatcggggtggggatatgttgcgggtgggagatcgcgtaattcagctcaagaac
gactacgagcgagaggtattcaatggtgatttaggggtggttggatcgatcgattcaacc
gagcatgaggtgatgattcagttcgataatagagaagttatctatgattatgctgactta
aatgagttaggcttggcttggtcgattagcattcacaaatcccaaggttcggagtatcca
gtggtaattttgccgctctacatgcagcactatctgttgttgtcgaggaatttggtttat
accggattgacgcgggcgaagaagttagcgatcgtagtaggatcgaataaggcgatcggg
ttggctgtcaggcaaaatcaagttgggaaaagatatactcgcttaccagcaagattaggc
ggaaatacatcatctacaatccatcaatcttaa

DBGET integrated database retrieval system