KEGG   Chamaesiphon minutus: Cha6605_2113Help
Entry
Cha6605_2113      CDS       T02414                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cmp  Chamaesiphon minutus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cha6605_2113
Enzymes [BR:cmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cha6605_2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2166358..2166996
Genome map
AA seq 212 aa AA seqDB search
MTLSISPDDIRKQLISTESKSPVSEAEMQQAVRTLLIGLGEDPDREGLLDTPKRVVKALK
YLTSGYNQSLDELLNGAVFHEDASEMVLVRDIDLFSSCEHHILPIIGRAHVAYIPNGKVI
GLSKIARICEMYARRLQVQERLTAQIADAIQGLLKPQGVAVVIEATHMCMVMRGVQKPGS
WTVTSSMQGVFADDAKTRQEFMDLIRHRPSFH
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgacattatctatttcacctgacgatatccgcaagcaactcatcagcactgaatctaaa
tctcccgtttcggaagcagaaatgcaacaagcagtgcggacattgctaatcgggctgggt
gaagatcccgatcgcgaaggactcttagataccccgaaacgagtcgttaaagctcttaaa
tacctaacttctggctacaaccaatctttagatgaattgctcaatggagcagtgtttcat
gaggatgcgagcgaaatggtgttagttcgggatatcgatttatttagctcttgcgaacac
catattttaccgattatcggacgcgctcatgttgcttatatccccaatggaaaggtaatt
gggttgtctaaaattgcccgcatttgtgaaatgtatgcccgccgtttacaggtgcaagag
cgactgactgctcagattgctgatgcgattcaagggttgctgaagccccaaggagtggcg
gtggtaattgaggcgacgcacatgtgtatggtaatgcgcggggtgcagaagcctggttcg
tggactgtgacgagttcgatgcagggtgtttttgctgatgatgccaaaactcggcaggaa
ttcatggatttaattcgtcatcgtccatctttccattag

DBGET integrated database retrieval system