KEGG   Chamaesiphon minutus: Cha6605_2127Help
Entry
Cha6605_2127      CDS       T02414                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cmp  Chamaesiphon minutus
Brite
Enzymes [BR:cmp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Cha6605_2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2185899..2186936
Genome map
AA seq 345 aa AA seqDB search
MQLLNIDRRIQRWIYFAALIFGASLLVLFLQHRSSFQPSVTIPKQIEIALTGEPIQAIPQ
EIAINLPKVTLGEKLFQDVRLSTNNQKSCLSCHSFSLGGADGRSHSIGINGIPTEVNTPT
VFNARFNFRLNWNGKYTNLSDHLDALMSNPKVMGVQWPAAIRSLEQVPEYRQLFDRVYPD
GLTPTNIKDALVAYELSLNTPNARFDRFLLGDKQALTAAEIEGYRLFKANGCISCHQGVN
VGGNMFQPFGIMSDYFAARGRMTPADLGRFNVTKNEADRHLFRVPSLRNVALTAPYFHDG
SAKTLEEAIATMTKYQLGRTLPTEQIASIAKFLRTLTGEYRGKPL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcaattactgaatatcgatcggcgaattcaacgctggatttactttgcggctttaatt
ttcggcgcgagtctgctcgtacttttcttgcagcacagatcttcgttccagccgtctgtg
acaatacccaaacagatcgaaatagctctgactggcgaaccgatccaagcgattccgcaa
gaaatcgcaattaatctacctaaagtaacgttgggtgagaaattatttcaagacgtgcgc
ttgtctacaaataatcagaaatcttgcctcagttgtcacagttttagcttgggtggggct
gatggtcgttcccattcgatcggcatcaatggcatcccgactgaagttaataccccaacg
gtgtttaatgcgcggttcaactttcgactcaattggaacggaaaatataccaatcttagc
gatcatctcgatgcgctgatgagcaatccgaaggtgatgggcgttcaatggccagccgcg
attcgatcgttggagcaggtgccagaatacaggcagctattcgatcgggtttatccagat
ggactgactcccaccaatattaaagatgcgctcgtcgcttatgaattgtcgctcaatacg
ccaaatgcgcggttcgatcgctttttgctcggcgataaacaggcattgacagccgccgaa
atagagggatatcggttgtttaaagccaatggttgcatcagttgtcatcaaggggtgaat
gtcgggggcaatatgtttcaaccctttgggattatgagtgactattttgccgctcggggt
cggatgactccagccgatttaggtcgtttcaatgttaccaaaaatgaggccgatcgccat
ctatttcgggtgccgagtctacggaatgtcgcgctgactgcgccttactttcatgatggt
tcagccaaaactttggaggaggcgatcgccacgatgaccaaatatcaactcggtcgcact
ttgcctacagagcagattgcttcgatcgccaagtttttacgtaccctcactggtgagtat
cgaggcaaacccttatga

DBGET integrated database retrieval system