KEGG   Chamaesiphon minutus: Cha6605_2149Help
Entry
Cha6605_2149      CDS       T02414                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00220  Arginine biosynthesis
cmp00250  Alanine, aspartate and glutamate metabolism
cmp00471  D-Glutamine and D-glutamate metabolism
cmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cha6605_2149
   00220 Arginine biosynthesis
    Cha6605_2149
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Cha6605_2149
Enzymes [BR:cmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Cha6605_2149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AFY93234
UniProt: K9UGA1
Position
2215242..2216204
Genome map
AA seq 320 aa AA seqDB search
MSKRLAALDRAQLNELLTESRSIIETAGELPAYIPLLADPNRRFDLAIQVHQINGEILSS
VEAETFRFPLMSLIKPFVLLYLLQQSNRDLVFERVGKKPSDRPYNSIAQLEIDRYKPRNS
MINSGAIALTALLPGDPASNCCQNFCDWLNQVAGSQLSLDLDMLASVRSSPNPINQAIAH
LLHRGGYLDSHGLLPTLAIAKTLDVYEQICCFSGTIKDLGKLGLLLASPQNNLLASDLQI
VNALMLTCGMYEESGMYAVSIGLPLKSSVSGCVLAIVPGEGAIAVYSPPLNLAGNSIASL
FILERLAQTFNLSIFSPRSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaagattagcagcactcgatcgggcacaacttaatgaattgctaactgaatct
cggtcgataatagaaacagcaggcgagttgccagcatatattcctttactagccgatccc
aatcgtcgtttcgacctagcaattcaagtacatcaaattaatggagaaattctctcatct
gttgaagccgagacatttcgctttccattaatgagtttaatcaaaccattcgtattgctt
tatttattacagcagtccaatcgcgatttggtattcgagcgtgtgggtaaaaagccgagc
gatcgcccctacaacagcatagctcagttagaaatcgatcgatataaaccgcgcaattcc
atgattaatagtggtgcgattgcgcttacggctctgttacctggcgatccggcatcgaac
tgttgtcaaaatttctgcgactggttgaaccaagttgcaggtagccaacttagcttggat
ctagatatgctcgcatcagtgagatcgtctcccaaccccatcaatcaagcgatcgctcat
ttattacatcgcgggggatatctcgattcgcatggtttactgcctacactagcaatcgcc
aaaactttagacgtttacgaacaaatttgttgtttctcaggaacgattaaagatcttggc
aaactgggattattacttgccagccctcagaataatcttctcgccagcgatttacaaata
gtaaatgccctgatgttaacttgtggcatgtatgaagaatctggcatgtatgccgtctcg
attgggctgccattgaaatccagtgtcagcggctgtgtattggcgatcgttccaggtgaa
ggagcgatcgctgtctatagtccaccattaaatctagctggtaactctattgccagctta
tttatcctcgaacgattggctcaaacatttaatttaagtatcttcagtcctcgatcgatc
tag

DBGET integrated database retrieval system