KEGG   Chamaesiphon minutus: Cha6605_2149Help
Entry
Cha6605_2149      CDS       T02414                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cmp  Chamaesiphon minutus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cmp00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cmp00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cmp00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2215242..2216204
Genome map
AA seq 320 aa AA seqDB search
MSKRLAALDRAQLNELLTESRSIIETAGELPAYIPLLADPNRRFDLAIQVHQINGEILSS
VEAETFRFPLMSLIKPFVLLYLLQQSNRDLVFERVGKKPSDRPYNSIAQLEIDRYKPRNS
MINSGAIALTALLPGDPASNCCQNFCDWLNQVAGSQLSLDLDMLASVRSSPNPINQAIAH
LLHRGGYLDSHGLLPTLAIAKTLDVYEQICCFSGTIKDLGKLGLLLASPQNNLLASDLQI
VNALMLTCGMYEESGMYAVSIGLPLKSSVSGCVLAIVPGEGAIAVYSPPLNLAGNSIASL
FILERLAQTFNLSIFSPRSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaagattagcagcactcgatcgggcacaacttaatgaattgctaactgaatct
cggtcgataatagaaacagcaggcgagttgccagcatatattcctttactagccgatccc
aatcgtcgtttcgacctagcaattcaagtacatcaaattaatggagaaattctctcatct
gttgaagccgagacatttcgctttccattaatgagtttaatcaaaccattcgtattgctt
tatttattacagcagtccaatcgcgatttggtattcgagcgtgtgggtaaaaagccgagc
gatcgcccctacaacagcatagctcagttagaaatcgatcgatataaaccgcgcaattcc
atgattaatagtggtgcgattgcgcttacggctctgttacctggcgatccggcatcgaac
tgttgtcaaaatttctgcgactggttgaaccaagttgcaggtagccaacttagcttggat
ctagatatgctcgcatcagtgagatcgtctcccaaccccatcaatcaagcgatcgctcat
ttattacatcgcgggggatatctcgattcgcatggtttactgcctacactagcaatcgcc
aaaactttagacgtttacgaacaaatttgttgtttctcaggaacgattaaagatcttggc
aaactgggattattacttgccagccctcagaataatcttctcgccagcgatttacaaata
gtaaatgccctgatgttaacttgtggcatgtatgaagaatctggcatgtatgccgtctcg
attgggctgccattgaaatccagtgtcagcggctgtgtattggcgatcgttccaggtgaa
ggagcgatcgctgtctatagtccaccattaaatctagctggtaactctattgccagctta
tttatcctcgaacgattggctcaaacatttaatttaagtatcttcagtcctcgatcgatc
tag

DBGET integrated database retrieval system