KEGG   Chamaesiphon minutus: Cha6605_2160Help
Entry
Cha6605_2160      CDS       T02414                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cmp  Chamaesiphon minutus
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cmp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2232893..2233570
Genome map
AA seq 225 aa AA seqDB search
MLKFYYATISANSQRVWITLLEKQIPFEPIIVNLDGEQFQSEFTAINPLQQVPAIVDDGL
RIFESLAILDYLEAKYPVPELMPKELDKLAIARMISIISLTELQPAAITLSKQLIGVEID
PTSVEKARQRANAILQFFEDTIAGADSKLFGDRPYFTGNTFTIADIVAGTLVPSVAMFGI
SLDSYPGLNAWIERLSQRESFRQTAPTPEGVQAALPTIKKILETR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttttactacgcgacgatttcggccaattcgcaacgagtttggattacttta
ctagagaaacaaattccctttgaaccaattatcgtcaacctggatggcgaacaatttcaa
tccgaatttactgctatcaacccactgcaacaagttccagcgatcgtcgatgacggattg
cggatatttgaatcattagcgattttagactacctcgaagcgaaatatcccgtgccggag
ttaatgccaaaagaattggataaattggcaattgcgcggatgatttcgataatttcccta
actgagttacagcctgctgccattacattaagcaagcaactgataggagtagagatcgat
ccaacgagcgttgaaaaggcacgacaacgcgcgaacgcaattttacaattttttgaggat
acgattgctggcgcagacagcaagctgttcggagatcgcccctacttcactggaaataca
tttacgatagccgatattgtcgcgggtacgctggttccatctgtcgctatgtttggtatt
tcattagattcttatcctggtttaaatgcctggatcgagcgattgtcgcagcgcgagagt
tttcgacaaacggcaccaactccagagggggttcaggcggcattaccaaccattaagaaa
attctagaaacacgataa

DBGET integrated database retrieval system