KEGG   Chamaesiphon minutus: Cha6605_2176Help
Entry
Cha6605_2176      CDS       T02414                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cha6605_2176
Enzymes [BR:cmp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cha6605_2176
Transporters [BR:cmp02000]
 Other Transporters
  Pores ion channels [TC:1]
   Cha6605_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_N_4 Glutaredoxin GST_C_5 GST_C_3 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AFY93260
UniProt: K9UEN3
Position
2243350..2244009
Genome map
AA seq 219 aa AA seqDB search
MPTIQLYSAILCPFAHRVRLTLKEKGVPFESIEIDPQNKPANFLEISPYGKVPVLKHGDN
RIWESAIVNEYLEETFPNPPLLPTEPMQRAQARIWINFADTRLFATTGKLLHGRDSHPTA
LLTELIEHLRFMEHEGLCKNSTSAPYWMGTELSLVDLTFYPWFEQLAVLEHFRGFGLPSG
LDRLQEWQAAVAQRESVRSIANSPEFYLERYGRLVQAKF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaattcaactttacagtgcaattctgtgtccttttgcccaccgagtacgatta
accttaaaagaaaaaggtgttccctttgagtcgatcgaaatcgacccccaaaataagcct
gctaactttctcgaaatttcgccttatggcaaagtccccgtcctcaaacatggcgataac
cgcatctgggaatcggcgatcgtcaatgagtatttagaggaaaccttccccaatccgcca
ctgttacccacagagccgatgcagcgggcacaggcacgcatttggattaattttgccgat
acccgcttgttcgctactaccggaaaactgttacacggtcgcgactcacacccaacggcg
ttattaacagagctgatcgagcatttgcgcttcatggaacatgagggtttgtgtaaaaat
tccaccagtgcgccctactggatggggacagagctgagtctcgtcgatctgactttttac
ccttggttcgagcaattagccgtgttggagcacttccgaggctttgggttgccatctgga
ctggatcgacttcaggaatggcaagcagcagtagctcaacgggaatcagtccgatcgatc
gccaattcgccagaattttatctcgaacgctacgggcggctggttcaagctaagttctag

DBGET integrated database retrieval system