KEGG   Chamaesiphon minutus: Cha6605_2684Help
Entry
Cha6605_2684      CDS       T02414                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cmp  Chamaesiphon minutus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cha6605_2684
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cha6605_2684
Enzymes [BR:cmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cha6605_2684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2784743..2785633
Genome map
AA seq 296 aa AA seqDB search
MKIRRRPPSSSVNVGPLEYQIIVPENQPNHILEEIVWDKEREVPVLRDKMPLDKLKKQVS
VMPPPLDFLGALKSGKTSPAVIAEVKKASPSRGVIRADFDAVEIAKSYQRGGASCLSVLT
DRTFFQGSFENLAAVRQAVDLPLLCKEFIIYAYQIYYARAHGADAVLLIATILEDTDLQY
FLKIVHALGMTALIEVHTQEEFDRVLKLNGVKLIGINNRNLADFSVDLQTTQMLLASRQQ
ELEERGILIVSESGLHTAEDLKIVVEAGASAVLIGESLVKQDDPGQAIVDMFASST
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcgtcgtcgtccccccagttcatcagtaaatgtcggcccactagaatatcag
attatagttcctgaaaatcaacccaaccatattctcgaagaaatagtctgggataaagaa
cgggaagttcccgtgctgcgggataaaatgcccctagacaagttaaaaaaacaagtaagt
gtaatgccaccgccattagactttctgggtgctctcaagtcaggaaagaccagtccggcg
gtaattgccgaagtcaaaaaggcttcccccagtcgtggggtaattagagccgattttgat
gctgtcgagattgccaaatcttatcagcggggtggggcgagttgtttgtcggtgttgacc
gatcgaaccttctttcagggtagttttgaaaatttggcagccgttcgtcaagctgtagat
ttaccgctgctgtgtaaggaatttattatctatgcttaccagatctattacgcacgcgct
cacggtgcggatgcggtattgttgattgccacaattttagaagataccgatttgcaatat
tttctgaagatcgtccatgcgttggggatgacagctctgattgaggtgcatactcaagaa
gaattcgatcgggtgttgaaattaaatggcgtcaaactgattggcattaataaccgcaat
ctcgctgattttagcgtcgatttacaaaccactcagatgctgttggcatcgcgacagcag
gagctagaggagcgcggcatcctcattgtcagcgaatctgggctgcatacggctgaagat
cttaaaatagtagtcgaggctggagctagtgcggtactaattggggaatccttagtaaag
caggacgatcccggacaagcgatcgtcgatatgtttgcctcatcaacgtag

DBGET integrated database retrieval system