KEGG   Chamaesiphon minutus: Cha6605_2835Help
Entry
Cha6605_2835      CDS       T02414                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cmp  Chamaesiphon minutus
Brite
Enzymes [BR:cmp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cha6605_2835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2964826..2966028
Genome map
AA seq 400 aa AA seqDB search
MSKLYLQRLLSRRQFFIGGISTATAIATLFLTKLQVLSYLIYPFKSEAGKLADLQSRKFV
VVGKKSLQQRARSKGIIYGAFPEADDRKFAKDSEFRSKLVSECKMMPVGTYWYTHRPKPD
TFDFTSSDYFVKFGTENKLLMRGHPLVWHEFLPDWVAATVTKDNAKQILTNHVETIVKRY
AGKIHSWDVVNEGIDISKGRRADGIRNSLWMKFLGADYLDIAFRTAAKADPRAKLVYNDF
GVEYDSAGYDEKREAILNLLQRLKSNGTPIYALGIQSHLFGDRHPFKPRKFQEFLKNVAS
LGLKIMITELDVEDRHLPKDIAQRDRLVAAAYEDYLAVALAQKAVVSVTTWGLSDRYTWL
AGHNFRADKAEKRPLPFDRNLKPKLAWNAIARAFDRAPKR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattatatttgcaacgtttattgtctagaagacaattttttattggcggaatt
agtacggcgacggcgatcgcgactttatttttaactaaactccaagtcctgagttatcta
atttatcccttcaagtccgaggcgggtaaattagccgatcttcagtcgcgaaaatttgta
gtcgttggtaaaaagtcactccagcaacgcgctcgatcgaaagggataatttatggagcc
tttccagaggcagacgatcgaaaatttgctaaagattccgagtttagatctaaattagtc
agcgaatgtaagatgatgccagtgggtacttactggtatacccatcgacctaagccggat
acttttgactttactagttctgactactttgtgaaattcggcacggaaaataaactgctg
atgcgcggacatcccctagtgtggcacgagtttttacccgactgggtggcagcaacagtg
actaaagacaatgccaagcaaattttgactaatcatgtggaaacgattgtcaagcgttat
gccggaaaaattcactcgtgggatgtcgtgaatgaaggcatcgatattagtaaaggtcgg
cgtgctgacggcattaggaatagtctgtggatgaagtttttaggagctgattatctggat
attgcctttcggacggcggccaaagccgatccgcgcgctaaattagtttataacgatttt
ggcgtagaatacgactccgctggatatgacgaaaagcgcgaagcgatcttaaatttatta
cagcggctcaagtcaaatggaacgccaatttacgcgctaggtattcagtcacatttattt
ggcgatcgccatccttttaaaccccgtaaatttcaagagtttctcaaaaatgtcgctagt
ttaggtctaaaaattatgattaccgaactagatgtcgaagaccgtcacttaccaaaagat
atcgcacaacgagatcggttagttgccgcagcgtatgaagattatctggccgttgctttg
gctcaaaaggccgttgtttcggtcactacttggggattgagcgatcgctatacttggctg
gcaggtcacaattttcgcgccgataaggccgagaaacgtcccttgcctttcgatcgcaac
ttaaaacccaaattagcttggaatgccatcgcgcgggctttcgatcgcgcgccaaaacgc
taa

DBGET integrated database retrieval system