KEGG   Chamaesiphon minutus: Cha6605_3250Help
Entry
Cha6605_3250      CDS       T02414                                 

Definition
arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cmp  Chamaesiphon minutus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cha6605_3250
Enzymes [BR:cmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cha6605_3250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3419694..3420737)
Genome map
AA seq 347 aa AA seqDB search
MSEHRPSTNLDNYDPSDVGRVNGNLFGLPFDAESAKTIVFGVPWEVTVSYNPGTAAAPQQ
ILDASPQLDLYDFDNPQGWQGGIYMPPVDTDLLAKNSYYRQQAALIIDRLERGESLNTEP
DLTPILAEINRAGAALNQWLFDRTQSAISKGKKVGVIGGDHSVPLGYMQALATHYPDFGI
LHIDAHSDLRDAYEGFEFSHASIMFNALKIPQISKLVQVGIRDVSKVEIDTIDRSQGRAI
AYYDSLIKQQLYAGTTWMSICQEAIAHLPAKVYISFDADGLDPKLCPNTGTPVPGGLELE
QAFCLCREVIRSGREIIGFDLCEVGNAEWDGNVGARIVYKLINLMNL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacatcgaccctcaactaatctcgataactacgatccgagcgatgtcggtcga
gttaatggtaacttattcggcttaccattcgatgcagaatcggcaaagacgatcgtgttt
ggtgtgccttgggaagtaactgtttcttacaatccggggacagcagccgcaccacaacag
attctcgatgcttctccacaattagatttatacgatttcgataacccccaagggtggcaa
ggtgggatttacatgccgccagtcgatacagatttacttgccaaaaatagttactatcgg
caacaagcagccttaattatcgatcgattagaacgcggtgaatcgctcaacacagagcca
gatttgacacccatattagcagagataaatcgagcgggtgccgcactcaatcaatggtta
ttcgatcgcactcaatcagcaattagcaaaggaaaaaaagttggcgtcattggtggcgat
cacagtgtgcctttggggtacatgcaggctttagcgactcattatcccgatttcgggatc
ttgcatatcgacgcgcattcagatttgcgcgatgcttatgaaggcttcgagttttctcat
gcgtcgattatgtttaatgcactcaaaatcccccagatttctaaactagtacaggtggga
attcgggatgtttctaaagtagaaatagatacgatcgatcgatcgcaaggacgcgcgatc
gcttattatgattcgcttatcaaacaacagctctatgctggtactacttggatgagcatt
tgccaagaagcgatcgcccatttacccgctaaagtttatattagtttcgatgccgatgga
ctcgatcccaaactttgcccgaatacaggtacaccagtgcctggtggcttagaattggag
caagctttttgtttgtgtcgtgaagtaattcggagtggcagagagattattggcttcgat
ctgtgcgaagtgggaaatgcagaatgggatggtaatgttggtgcaagaatcgtttataaa
ttaatcaatttgatgaatttatag

DBGET integrated database retrieval system