KEGG   Chamaesiphon minutus: Cha6605_3541Help
Entry
Cha6605_3541      CDS       T02414                                 

Definition
PAS domain S-box
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
cmp  Chamaesiphon minutus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cha6605_3541
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Cha6605_3541
Enzymes [BR:cmp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Cha6605_3541
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Cha6605_3541
Two-component system [BR:cmp02022]
 CheA family
  CheA-CheYBV
   Cha6605_3541
Bacterial motility proteins [BR:cmp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cha6605_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3725377..3728964
Genome map
AA seq 1195 aa AA seqDB search
MSSHQSADSAQEGLADSLMCPIVGIGASAGGLEAFTQLLEHLPTDTGMAFVLVQHLDPTH
ASLLTQVLAKITAMPVAEVADGVAVMPDRVYAIPPNRELILVGNNLKLLARRQDRRRFLP
IDRFFQSLATDRQHLAIAVVLSGADGDGSIGLAAVKAAGGITFAQDIASSKFEGMPKHSI
ATGCVDFILPPEAIAAELGAIGRHSRVARIPQHSSVKSVVGENQSESIAKIFNLLRTEKS
VDFTGYKPATLKRRIVRRMALHDLERWDDYVRFLQTNPAELHELERDLLINVTSFFRDPA
IFNAFKNTVFAEIVAQKSPGVPIRIWVAGCSTGEEAYSLAMCLLEYLEECQIQIPIQIFA
TDISEAAIAIARRGIYKPGMMGRVTSDRLHRFFVEVEDGYQIGKSVRELCVFARQNLIAD
PPFSQLDLISCRNVLIYLGADLQKRLIPIFHYALKPNSFLMLGTSESIGKFSDLFVPVDN
KSKIYARKLAPKSPYLKFNSSERALKKVKPMMPIDEDSRNDRDLLQQADRLVLDRYAPVG
VTIDNDMNIVQFRGQTGNYLEPPTGKPSFNLFKMAKPELAVELRAVVHQARQQQEIIRQE
GVQVKTADGIKTIAIEAIPFQSGTDGRPYLLVLFQESAIAVDAATPALVQSKKGKQAALD
RENTRLLQELTTTRECLEAIIEEQESTNQALQVANEEILSSNEELQSTNEELETSQEELQ
ATNEELHTINEELNSRNSELSQINNDLQNLLSSINIPILMLDGELRIRRFSALAQQIFNL
IPTDLGRPFSDIKPKISIPDLSESILEVIQTLATKEQEVQDRTGNWYSLRIRPYRTSDNR
IDGVTIGLIDIDTMVRNAAVVEAARDYANAIVETVHQPLLVLDADLCVIRANQCFYESFG
LTPDRTERQSIFELEDRVWDIPSLRSLLETAIDRDTEFQDFEVIHTRPAESPRILLLNAR
KIRDDRQEDSILLAIEEITARRQSEAQIQESLAEKEVLLGEIHHRVKNNLQIVSSLLSLQ
NNRVTDSQANTILQDSQNRVSAMAAIHEILYRSSNLAALNFDEYVRTLVDNLFASYTVDR
AAISLSVEVSPDVDIDVDRAVLCGLIINELVTNALKYGFADGREGELSIHLISSNQILTL
AVANNGRELPLDFDIRNIRSMGLNLVMSLVKQIKGELTVETGAMTVFKITFPKSI
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacatcaatcggcggattctgcacaagaggggctagcagatagcctaatgtgt
ccgatcgtaggaattggggcttcagcgggcgggttagaagcatttacccaactgctcgaa
cacctaccgacagatacggggatggcgttcgtgctggttcagcatttagatcccacacat
gctagcctcctgacgcaagtgttagcaaaaataacggcgatgcccgttgccgaagttgct
gatggggtggcggtgatgcccgatcgagtatatgcgatcccgcccaaccgcgaattaatc
ttggtcggcaataacctcaagcttttggcgcgtcggcaagatcgccgtcggtttttaccg
atcgatcggttttttcaatctttagcaacagatcgccaacatctggcgatcgcggtggta
ttatcgggtgccgatggcgatggctcgatcggattagccgcagtcaaagcggctgggggg
attaccttcgctcaagatattgcctcgtccaaatttgagggaatgccaaaacactcgatc
gcgacaggttgtgtcgattttatcttaccaccagaggcgatcgcggcggaattaggcgcg
atcggtcgtcactcccgtgtcgctcgtatcccgcagcactcatcagtgaagtcagttgtg
ggcgagaatcagagcgagtcgatcgcgaagattttcaacctactcagaaccgaaaaaagt
gttgactttacaggttataagcctgctacgctcaaacggcggatcgtgcgccggatggct
ttacatgatttggaacggtgggatgattacgtccgttttcttcagactaatccggcagaa
ttacacgagttagagcgcgatctgttgattaatgtcactagttttttccgcgatcccgca
atttttaatgctttcaaaaacacggtatttgcggagattgttgcccaaaaatctccagga
gtgccgattcggatttgggtggcgggttgctcgactggcgaagaagcctactcgttagcg
atgtgcttgttagaatatttagaagaatgccagattcagatcccgattcagatttttgcg
actgatattagtgaagccgcaattgcaatcgccagaagaggcatctataaaccggggatg
atgggtagagttacaagcgatcgattgcaccgcttttttgtcgaagttgaggatggttat
caaatcggcaaatctgttcgcgagttgtgtgtttttgccagacaaaatctgattgccgac
ccgcctttttcgcaactcgatctgattagttgtcggaatgtattaatttatttaggcgcg
gacttacaaaaacgattgattccaatttttcactatgctctcaaacccaatagttttttg
atgttgggtacttccgaaagcatcggtaaattttctgatttattcgtacctgtagataat
aaatctaaaatttatgcgcgcaaattggcaccaaaaagtccatatctaaaatttaatagt
agcgagcgcgctctcaaaaaagtgaagcccatgatgccgatagatgaagatagtcgcaac
gatcgagatttactccaacaggcagatcggctcgtcctcgatcgctatgcacctgttggc
gtgacgatcgataatgacatgaatatcgtccaatttcgcggccagactggaaattatctc
gaaccacccacgggcaaaccgagcttcaatctgttcaaaatggccaaacccgaattagca
gtcgaattacgtgccgtcgtccatcaggctaggcaacagcaagaaatcattcggcaagaa
ggtgtgcaggtaaaaactgccgatgggataaaaacgatcgcgatcgaagcgatcccattt
cagagcggtacagatggtagaccctatttattagttctatttcaggaatcggcaatcgct
gttgatgcagctacacccgcgctcgtccagtcgaaaaagggcaagcaagcagccttagat
cgagaaaatacccgactcctccaagaactaacgacgacgcgagaatgtttagaggcaatt
attgaggagcaagaatcgaccaatcaagctttacaagtagcaaatgaagagattttatcg
agtaatgaggagctacaaagtacgaatgaagagttagaaacctctcaagaagagttacag
gcaactaacgaagaattgcacaccattaatgaagaactcaatagccgcaatagcgaactc
agtcagattaataacgaccttcagaatttgttgagcagcattaatattccgattctgatg
ctcgatggcgagttgcgaattcggcggttttccgcgctagcgcaacaaatttttaacctg
attccgacagatttagggcgaccatttagcgatattaaacccaagatatcgattccagat
ctgagcgaatcaattctggaggtgattcagacattagccaccaaagagcaagaggtacag
gatcggacagggaattggtatagtttgcggattcgaccataccggacgagcgacaatcgg
atcgatggggtgacgatcgggttaatcgatatcgatacgatggtgcgcaatgcggcagtc
gtcgaagccgcacgggactatgccaatgcaatcgtcgaaactgtccaccaacccctgctg
gtgttagatgcagacttatgcgtaattcgcgccaatcaatgtttttacgaatcttttgga
ctgacacccgatcgcaccgagcggcaatcgatctttgagttggaggatcgggtgtgggat
attccgagtttgcgatcgctgctcgaaaccgcgatcgatcgagataccgagtttcaagac
tttgaggtcattcatacccgtcctgccgaatcaccgcgcattcttttactcaatgcacgc
aaaattagagacgatcgtcaagaagatagtattctgctagcgatcgaagaaattaccgcc
cgtcgccaatccgaagctcagatccaagaatccctcgccgaaaaggaagtattactggga
gaaatccatcatcgggtcaaaaacaatctccaaattgtttctagtctgctgagtctgcaa
aacaatcgcgtcaccgattcacaagcgaacacaattctccaagatagtcaaaaccgtgtc
agtgcgatggcagcaatccacgagattttgtatcgatcgtctaatttagcagctctcaac
tttgatgaatacgttcgcaccttggtcgataatctgtttgcaagctacaccgtcgatcga
gcggcgatttccctgagtgtggaagtgtcaccagatgtagatatcgatgtcgatcgagcc
gtgttgtgtggcttaattattaacgaattagtcactaacgctctcaaatatggctttgca
gacggtcgggaaggtgaattatcgatccacttaataagtagtaaccagatcctgacatta
gccgtggcaaataacggtcgggaactacccctagattttgatattcgtaacattcgatcg
atgggactcaatctagtcatgtctctggttaaacaaatcaaaggcgaactaactgtagaa
accggggcgatgactgtgtttaaaatcacctttcccaaatcaatctag

  All links  
No link information was found.   
DBGET integrated database retrieval system