KEGG   Chamaesiphon minutus: Cha6605_3598Help
Entry
Cha6605_3598      CDS       T02414                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cmp  Chamaesiphon minutus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cmp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3787950..3789122)
Genome map
AA seq 390 aa AA seqDB search
MKAITLLGSTGSIGTQTLDIVEHNPDKFRIVGLAAGSNVEMLARQVRQFRPEIVAIGNEA
KLAELKDTLSDLDYRPIIVAGAQGTIEVAGYGDAQSVVTGIVGCAGLLPTIAAITAGKDI
ALANKETLIAGGPVVLPLVEKHGVQLLPADSEHSAIFQCLQGVPAGGLRRIILTASGGAF
RDLPAEKLASVTIADALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGLDYDDIDIVV
HPQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYAMSWPDRISTNWEKFDLVKAGDLTFRAP
DRVKYPCIELAYAAGRAGGSMPAVLNAANEQAVALFLSEKIHFLDIPKVIEKVCDKHRTD
LTLTPSLDDILAADVWARQMVIEFSQQFTA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgattactttactcggctctactggctcgatcggcactcaaaccctagatatc
gtcgaacataaccccgataaatttcggattgtcggattggctgcggggagtaatgtcgag
atgttagctcggcaagtgcgccagtttcgacctgaaattgtggcaattgggaatgaagcc
aagttagccgagctaaaagacacgctctcagatttagattatcgcccgattatcgtcgct
ggcgcacaagggacgatcgaagttgctggttatggtgatgctcaaagtgtcgttacgggt
atcgtcggttgcgcgggactcctcccgacaattgccgcaattaccgcaggtaaagatatc
gccctagctaataaagaaaccctgatcgcaggcggccctgtagtactaccattagtcgag
aaacatggagtccaattactccccgccgactccgaacattcggccatctttcaatgcttg
caaggcgttcccgctggtggcttgcgccggattatcctcacagcttctggtggtgccttc
cgcgatctccctgccgaaaaattagcctcagtcactattgctgacgccctcaagcaccca
aattggtcgatgggacaaaaaatcacgatcgactccgccacgctgatgaacaagggttta
gaggtgattgaggcacattatttatttggcttagactatgacgatattgatatcgtcgtt
catccccaaagtatcattcattccctcatcgaagtccaagatacatccgtcttggcgcaa
ttaggttggccggatatgcgcttaccattactatatgccatgtcctggcccgatcgcatc
tccactaactgggagaaattcgatctcgtcaaagctggcgatctgacatttagagcaccc
gatcgagttaaatatccttgtatcgaattagcctacgccgccggacgtgctggcggctcg
atgccagcggtactcaatgcagcaaacgagcaagcagtagcactctttttgtccgagaaa
attcacttcctagatattcccaaagtcatcgaaaaagtctgtgacaaacatcgcaccgat
ttgactttaacgcctagtttagatgatattttagccgccgatgtttgggcgcgccaaatg
gtaatcgaatttagtcaacaatttactgcctag

DBGET integrated database retrieval system