KEGG   Chamaesiphon minutus: Cha6605_4040Help
Entry
Cha6605_4040      CDS       T02414                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cmp  Chamaesiphon minutus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cmp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cmp00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4256082..4257410
Genome map
AA seq 442 aa AA seqDB search
MLRIITQQTEAQQELQRISARTHDDAIVHKEATVNEIVQTVRRQGDKALLHYTAEFDGQA
LTVDRLRVSGAELDAAYQQVSKELLKAIELAAQNIEAFHRQRMPKSWVTFGEDDVVLGKR
YNPVDRAGIYVPGGRACYPSTVLMNAIPAKVAGVPQIAMVTPPGADKNLNPAVLVAAQVA
GIEEIYRVGGAQSIAALAYGTDTIAKVDVITGPGNIYVTLAKKLVYGTVGIDSLAGPSEV
LIIADRNANPQHVAVDLLAQAEHDPMAAAILITTDMGLATAVQAAVEQQLVNHPRRTLTE
KSIAHYGLIAVVDTLEQAAELSNRFAPEHLEIKTDDPWALIDRIRHAGAIFLGDSTPEAV
GDYLAGPNHTLPTSGAARYASALGVETFMKHSSLIQYSPAALGKVGNAIQALTQAEGLFS
HGESVRLRLNDAATDRLRQRDE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcatcactcagcagactgaagcgcaacaagagttgcagcgaatcagtgcc
cgtacccacgacgatgcgatcgtccataaagaagccaccgtcaacgagattgtccaaaca
gtcagacgacagggcgacaaggctttgctacactatacggctgaatttgacggtcaagct
ctgacagtcgatcggttgcgggtcagtggtgccgaattagatgctgcctatcaacaggtg
tctaaggagttactcaaggcgatcgaacttgccgcccaaaatatcgaggcttttcaccgc
cagcggatgcccaaatcttgggtcacctttggtgaggatgatgtcgtgctgggcaaacga
tacaatcccgtcgatcgggcgggcatctacgtgccaggaggccgcgcttgctaccccagc
acggtgctgatgaatgccattcctgctaaagtcgcaggcgtgccgcagatcgccatggtg
accccaccaggagctgataaaaatctcaatcctgccgtcttggttgccgctcaagtcgct
ggcatcgaagaaatctatcgggtgggtggtgctcaatcgatcgccgctttagcatacggt
accgatacgatcgctaaagtagatgtcattacaggaccgggtaatatttatgtcaccctc
gccaaaaagttagtctacggcaccgtggggatcgattccctcgcagggccatccgaagtg
ctaattattgccgaccgcaatgccaatccccagcacgttgcggtcgatttgttagcccaa
gccgaacacgatccgatggctgcggcaatcttgattaccaccgacatgggtttagctaca
gccgttcaagccgcagtcgagcaacaactggtaaatcatccccgccgcacgctcaccgaa
aaatcgatcgcccattacggactgatcgcggtagtcgatactctagaacaagctgccgaa
ctctctaatcggttcgcaccagaacatttagaaattaaaactgacgacccttgggcatta
atcgatcggattcgtcatgctggggcgatcttcttgggtgattcgactccagaagcggta
ggcgactacctggctggcccgaatcataccttgccgacatctggtgccgctcgttatgct
tcagccttgggtgtcgaaacatttatgaagcactctagtctaatccaatattcgccagca
gctttaggcaaggttggcaatgcgattcaagctctcacccaagctgaaggactattctcg
catggggagtcggtacgcctgcggttgaacgacgctgctaccgatcgactgcgtcaacga
gacgaataa

DBGET integrated database retrieval system