KEGG   Chamaesiphon minutus: Cha6605_5134Help
Entry
Cha6605_5134      CDS       T02414                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cmp  Chamaesiphon minutus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Cha6605_5134
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Cha6605_5134
Enzymes [BR:cmp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Cha6605_5134
Lipid biosynthesis proteins [BR:cmp01004]
 Desaturase
  First
   Cha6605_5134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5421023..5421850
Genome map
AA seq 275 aa AA seqDB search
MTVAASTKLRLDWTMIIALVIFHIGAICAFLPGLFSWKAVGVALLLHWITGGLGITLGWH
RLLSHRSFQVPKWLEYFFAFCGTLALQGGILWWVGLHRHHHLHSDQDVDHHDSKKGFLWS
HVRWMCFEVPAESDIPRFTKDIADDRFYQFLNKYFFPLQVVLGVVLYAIGGWPFVFWGVF
ARLVIVYHCTWLVNSATHKFGYRNFETTDNSTNCWWVAITTYGEGWHNNHHAYQYSARHG
MKWWEIDITWMTIQVLQFLGLATKVKLVEAGTAKD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgccgcatcaacaaaacttcgtctcgattggacgatgattatcgcgctcgta
atttttcacattggagcgatttgcgcctttttaccgggactatttagttggaaagccgtg
ggtgtagcattactgctgcactggattacaggtggtttggggattacattagggtggcac
cgtcttctctctcaccgtagctttcaggttcccaaatggttggaatacttttttgctttt
tgcggcacattagcattacaaggtggaattctatggtgggtaggtttgcaccgtcaccat
catttgcattcagatcaagatgtcgatcatcacgattccaaaaaaggcttcttgtggagt
cacgtccggtggatgtgttttgaggtaccagcagaaagtgacattccccgctttaccaaa
gatattgctgacgatcggttttatcagtttttgaataaatacttcttccccttgcaagtc
gtgctcggcgtagtcttatatgcgatcggcggttggccgtttgtgttctggggtgtattt
gctcgcctggtaatcgtttatcactgtacttggctcgttaatagcgcgactcacaagttt
ggctatcgcaactttgaaactaccgataattctaccaattgctggtgggtagccatcact
acttacggtgaaggctggcacaataaccaccatgcttaccaatattctgcacgtcatggt
atgaaatggtgggaaattgatatcacttggatgacgattcaagtactgcaatttcttggt
ttggctactaaagtgaagttggtagaagctggcacagcaaaggattaa

DBGET integrated database retrieval system