KEGG   Chamaesiphon minutus: Cha6605_5275Help
Entry
Cha6605_5275      CDS       T02414                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cmp  Chamaesiphon minutus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cha6605_5275
DNA repair and recombination proteins [BR:cmp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cha6605_5275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5572566..5573279
Genome map
AA seq 237 aa AA seqDB search
MEIKCAHYPLPITHQPIHPSTQLTSSAIIIIQRSSGAKITAYTRPLANLIEQLQRLPGVG
PKSAQRLALHILKRSATEVEQLAQALIEAKQQVGLCQVCFHLSAEPICDICRNPQRDRQT
ICIVADSRDVIALERTREFSGQYHVLGGIISPMDGIGPEQLNISSLLRRINEQDVKEAIV
AVSPTVEGETTTLYLGRLISPLTKVTRIAFGLPMGGDLEYADEITLARALEGRREIN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttggaaataaaatgcgcccattacccactacctattacccatcaacccatccacccatcc
acccaactgacatcctctgctataataatcatccagcgatcgtcaggagcgaaaattacg
gcttatacgcgcccccttgctaacttaatcgagcaactacaacgcttgcctggagtaggt
cccaaatctgcccagagattggctttacatattcttaaacgatcggcaacagaggtcgag
caattggctcaagctttgatcgaggccaagcagcaagtcggcttgtgtcaggtttgtttt
cacctatctgccgaaccaatttgcgatatctgtcgcaacccgcagcgcgatcgacaaact
atctgtatcgtcgctgattctcgcgatgtgattgctttagaaagaacgcgagaatttagc
ggtcaatatcatgttttgggtgggattatttcaccgatggatggaattggccccgagcaa
ttaaatatttcatcattgttacgacgcatcaatgagcaagatgtcaaagaagcgatcgtg
gcagtgagtccgacagtcgaaggcgagacaacaactttatatctcggtagactgatctcg
ccgctgaccaaagtgacgagaattgcctttggactgcccatgggcggcgatctggaatat
gcagacgaaataactctcgcccgcgctctagaaggcaggcgagagataaactag

DBGET integrated database retrieval system