KEGG   Chamaesiphon minutus: Cha6605_5308Help
Entry
Cha6605_5308      CDS       T02414                                 

Definition
(GenBank) alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00500  Starch and sucrose metabolism
cmp01100  Metabolic pathways
cmp01110  Biosynthesis of secondary metabolites
Module
cmp_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cha6605_5308
Enzymes [BR:cmp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cha6605_5308
Exosome [BR:cmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cha6605_5308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AFY96195
UniProt: K9UN00
Position
complement(5610797..5613109)
Genome map
AA seq 770 aa AA seqDB search
MTLALEQIDRIVGNKHHNPFEILGPHQVKENGKNVWVVRSYIPNAESVSVMIPDARQEYM
MHSEHHPHFFSCTIDRSELSNYQLKITEGGHERVIYDPYAFTSPLLSDFDIHLFAEGNHH
RIYEKLGAHPIEVEGIKGIYFAVWAPNARNVSVIGDFNYWDGRKHQMARRENGIWELFIP
ELKVGASYKYEIKNQDGHPYEKTDPYGFYQEPRPKTASIVADLSIHQWQDEEWMEKRRHS
DLLRQPISVYECHLGSWLHAAANEPAQLPDGTTSPAVIVSDYNPGARFLTYRELADKLIP
YVQNLGFTHIELLPISEHPFDGSWGYQVTGYYAPTSRHGSPEDFMYFVDCCHQAGIGVIV
DWVPGHFPKDGHGLPFFDGTHLYEHADPRKGEHKEWGTLIFNYGRNEVRNFLYANALFWF
DKYHIDGIRVDAVSSMLYLDYCREPGEWVANQYGGRENIEAADFLRQTNHLIFSYFPGAL
SIAEESTAWPMVSAPTYLGGLGFNLKWNMGWMHDMLDYFEMDPWFRQFHQNNITFSMWYN
HSENFMLALSHDEVVHGKSNIIGKMPGDEWQKLANMRCLYAYMFTHPGKKTLFMGMEFAQ
WSEWNVWSDLEWHLLQYAPHQQMSQFLTELNYVYRHEPALYSQDFEEPGFEWIDCTDSRH
SVVSFIRRDKNSNDCVIVVCNFTPQPHAHYRIGVPEHGFYHELFNSDARKYGGSNMGNLG
GKWADEWSIHNRKFSLDLCIPPLGVSIFKIDRERTAAAYEWRDNNAIEGT
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgactcttgccttagaacagatcgaccggattgttggaaataaacatcacaatcccttt
gaaatattaggtcctcatcaagttaaggaaaatgggaaaaacgtttgggtggtgcgtagt
tacatccccaatgccgagtccgtctcggtaatgattcccgacgcgcggcaggagtatatg
atgcactcagagcatcatccacacttctttagttgcacgatcgatcgatccgaattgagc
aactatcagcttaagattaccgaaggcggccacgagcgggtaatttacgatccttatgca
tttacttcaccattattaagtgactttgatattcacttatttgctgaaggaaatcaccac
cgaatttatgaaaagctcggcgcacatccgatcgaagttgaaggtattaaaggtatctat
tttgccgtttgggcaccgaacgcacgtaacgtttcggtaataggtgattttaactactgg
gatggacgcaagcaccagatggccagacgggagaacgggatttgggaattatttatcccc
gaactcaaagttggtgcctcttataaatacgaaattaaaaatcaagacggtcatccttac
gagaagaccgacccgtatggattttatcaagaacctcgccccaaaacggcctcgatcgtt
gccgatctgagcattcaccaatggcaagatgaggagtggatggaaaagcgtcgccatagc
gatcttttgcgccagccgatttctgtctatgagtgtcacctgggttcctggctacatgcc
gcagccaacgaaccagctcaattaccagacggcaccacctcgccagcagtaattgtttct
gactataatcctggcgcacggtttctcacctaccgtgaattagctgataaattaattcct
tacgtccagaatttgggctttacccatatcgaactgttacccatctccgagcatccgttc
gatggctcctggggttatcaggtaacgggttactatgcgccgacatcgcgacatggttcc
cctgaagattttatgtattttgtcgattgctgtcaccaggcaggtatcggtgtaatcgtc
gattgggtacccggacatttccccaaagacggacacggtttgcccttcttcgatgggact
catctttacgaacatgccgacccccgcaaaggcgaacataaagagtggggaactttaatc
tttaactacggacgcaacgaagtcagaaatttcctctacgctaatgctctattttggttc
gataaataccatatcgatggcattcgcgtcgatgccgtcagctcgatgctgtacctcgat
tattgtcgcgaacctggtgaatgggtagccaaccagtacggcggacgggaaaatatcgaa
gccgctgacttcttgcgccaaaccaatcatctcatctttagttacttcccaggcgcacta
tcgatcgccgaagaatccaccgcatggccgatggtatctgcgcctacctacttaggcggc
ttaggtttcaacctcaaatggaacatgggttggatgcacgacatgctcgattattttgag
atggacccttggttccgccagttccaccaaaataacattacctttagcatgtggtacaac
cacagcgagaactttatgctcgcgctctcgcacgatgaggtagtccacggtaagagcaat
atcattggcaaaatgccaggtgacgagtggcagaaactcgccaatatgcgctgtctctat
gcctatatgtttactcatcccggcaaaaaaaccctgtttatggggatggaatttgcccaa
tggagcgagtggaatgtctggtcggatttggagtggcacttgctacaatatgccccccac
cagcagatgagtcaattcttgacagaactcaactacgtctatcgtcacgaacccgcactc
tacagtcaagactttgaggagcctggatttgaatggatcgattgtaccgatagtcgccat
agcgtggtgtcctttatccgccgcgataaaaatagcaatgattgtgtaattgtcgtctgt
aatttcacaccgcaaccgcacgcacattaccgcatcggcgtacccgaacacggtttttat
cacgagctatttaatagcgacgcgcgcaaatatggcggtagcaatatgggcaacctcggt
ggtaaatgggcagacgaatggtcgattcacaatcgtaaattctcgctagatctgtgcatt
cccccactaggtgtctcgatcttcaagatcgatcgcgaacgcaccgccgcagcctatgaa
tggcgcgataacaacgcgatcgaaggcacatag

DBGET integrated database retrieval system