KEGG   Chamaesiphon minutus: Cha6605_5375Help
Entry
Cha6605_5375      CDS       T02414                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cmp  Chamaesiphon minutus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cmp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5681407..5682903
Genome map
AA seq 498 aa AA seqDB search
MTRSSGILLHPTSLPSPFGIGDLGEDAYTFIDFLHDAKQKYWQILPLGPTGYGNSPYMCY
SAIAGNPLLISPVKLLKDELLTPTDLANLPTFPTHKVDFPLAIETKTKLFHIAFERFMTI
ADNEQKTNFDNFCHSQIYWLDDYALFMAVREAHGDKSWHQWEPDLVKREPIALIHWQNQL
KHQVCYHKFIQFKFFEQWSALRQYAHEHEVEIIGDIPIYVAHDSADVWANQEFFELDPET
SEPALMAGVPPDYFSETGQLWGNPVYHWENLAHTQFNWWIQRFESLLKLVDVIRVDHFRG
FQAFWAVEQGETTAMNGRWIKAPGAELFATIQHKWGRLPILAEDLGVITPDVEALRDQFG
FPGMKIIQFAFGSDNGNPFLPFNHGRNFVVYTGTHDNDTTVGWFEKLEGRERDRFLLYTG
GICKEGVHWDTIRLAMTSVANIAIFPLQDVLGLGGNARMNFPGSAEGNWEWRYDPAVINE
PLALRLKNLTLICGRCSN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctccagcggaattttgctccatcccacctcactacctagtccattcgggatt
ggcgacttaggtgaagatgcttatacgtttatcgattttttgcacgatgccaaacagaaa
tattggcagattctaccattagggccgacgggatatggtaattctccatacatgtgttat
tcagcgatcgcgggcaatccgttgctgattagtccagttaaactcttaaaggatgaatta
ctgactcctacagatctagcaaacttaccgacatttcctacccataaagttgattttcca
ctcgcgatcgagactaaaactaagctatttcatatcgctttcgagcgatttatgaccata
gcagataatgagcaaaaaactaattttgataacttttgtcacagtcagatttattggttg
gatgattacgccttatttatggcagtgcgagaagcacatggcgataagagctggcatcaa
tgggaaccagatttagtcaagcgcgaaccaatcgccttaattcattggcaaaatcaactc
aaacatcaagtttgctatcataaatttattcaattcaaattctttgaacagtggtcggca
ttgcgacaatatgcccacgaacacgaagtcgaaatcatcggcgatattccgatttatgtc
gctcacgatagcgcagatgtctgggcgaatcaagaattttttgaactcgaccctgaaacc
agcgaacccgcactaatggctggcgtaccgcccgattactttagcgaaaccggacaattg
tggggcaatcccgtctaccattgggagaatttagcacatacgcaatttaactggtggatt
caaagatttgaatcattattgaaattagtcgatgtgattcgcgtcgatcactttcggggt
tttcaagctttttgggcagtcgaacagggcgaaactacagcaatgaatggccgctggatc
aaagctcccggcgcagaattatttgccaccatccaacacaaatggggacggttgccaatt
ttagctgaagacttaggtgtaattacgcctgacgtcgaagctttgcgcgaccagtttgga
tttccaggcatgaaaatcatccaatttgcttttggttcggataatggtaatccgttttta
ccattcaatcacggacgcaattttgtagtctatacaggtacccacgataacgataccacc
gtcggttggtttgagaaattagaaggtcgcgaacgcgatcgattcttgctatatactggt
ggcatttgtaaggaaggagttcactgggacacgatccggttggcgatgacttctgttgca
aatatcgcgatttttccgctccaggacgtgttgggtttaggcggtaatgcgcggatgaat
ttccctggttctgcggaaggaaattgggaatggcgatacgatccagcagttattaacgag
ccactagcattacggttgaaaaatttaaccttaatctgcggtcgctgtagcaattaa

DBGET integrated database retrieval system