KEGG   Chamaesiphon minutus: Cha6605_5479Help
Entry
Cha6605_5479      CDS       T02414                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cmp  Chamaesiphon minutus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cmp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cmp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5795748..5796599
Genome map
AA seq 283 aa AA seqDB search
MTANLLEKREHSSQQQETAPLSWTNVFFFGSFHLIALAAPWYFNWSALGTAILLHWLFGS
IGICLGFHRLLTHRSFQVPKPLEYVFATLGALALQGGPIFWVAGHRQHHLYTEDWDKDPY
SAKRGFWWSHMLWIFYPKSNFFNLDEYKKAAPDLAKDAYYRWLDKYFLFLQIPVALLLYA
IGGWSFVIYGVFVRAVILWHSTWLINSASHITGYRSHESDDNSRNLWWAALLTYGEGWHN
NHHAYPNVAKGGWQWWEIDMTWWSIQLLQKLGLAKRVILPPTN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactgctaatttgttagagaagcgcgaacatagctcgcagcagcaggaaacggcacca
ttaagttggacgaacgtcttcttttttggctcttttcatctaattgccctagccgcaccg
tggtattttaattggtcggcactaggaacggcaatcttgctgcattggctgttcggatcg
atcgggatttgtttgggctttcaccgtttgcttacgcatcgcagcttccaggtacccaaa
ccgctcgaatatgtctttgccaccctcggtgccttagcacttcaaggcggcccgattttc
tgggtagctggacatcgccagcaccatttgtacaccgaagactgggacaaagatccctac
tcggcaaaacgaggcttctggtggagtcacatgctgtggattttctaccccaaatccaac
ttcttcaaccttgatgagtacaaaaaagcggcaccagatttagctaaagatgcttactac
cgttggctggataaatatttcttgttcttacaaattcctgttgcgctgctattgtatgcg
atcggcggttggtcatttgtaatttacggcgtgttcgtgcgggctgtgattctgtggcac
agcacttggctgatcaattctgccagtcacatcactggctatcgcagccacgaatcggat
gacaactcgcgcaatctctggtgggcggctctgctcacttatggcgaaggctggcacaac
aatcaccatgcttatcccaatgtcgctaaaggtggttggcagtggtgggaaatcgacatg
acttggtggtcgattcaattattacagaagctcggtttggcaaaacgcgtaattttacca
ccgactaattag

DBGET integrated database retrieval system