KEGG   Chamaesiphon minutus: Cha6605_5689Help
Entry
Cha6605_5689      CDS       T02414                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00010  Glycolysis / Gluconeogenesis
cmp00052  Galactose metabolism
cmp00500  Starch and sucrose metabolism
cmp00520  Amino sugar and nucleotide sugar metabolism
cmp00521  Streptomycin biosynthesis
cmp01100  Metabolic pathways
cmp01110  Biosynthesis of secondary metabolites
cmp01120  Microbial metabolism in diverse environments
cmp01130  Biosynthesis of antibiotics
cmp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cha6605_5689
   00052 Galactose metabolism
    Cha6605_5689
   00500 Starch and sucrose metabolism
    Cha6605_5689
   00520 Amino sugar and nucleotide sugar metabolism
    Cha6605_5689
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cha6605_5689
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cha6605_5689
Enzymes [BR:cmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cha6605_5689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFY96546
UniProt: K9UQ19
Position
complement(6000924..6001856)
Genome map
AA seq 310 aa AA seqDB search
MTEVIGIDLGGTAIKLGRFTEDGTCLQSLTVPTPQPAYPDDTIDMMTYAIEKLAPGLANI
NAIGVGTPGPADAVGRVAKVAINLKGWIDIPVATLIQSRTGVPTIVGNDANCAGLGEKWL
GAGRNYRNLVLLTLGTGVGGAVFLDGVLFTGHAGSAGELGLIAFDPDGHPCNSGNNGSLE
QFLSGQAIRRLTGKEPKELGILAAAGDRDALEFWNNYGRNLGIGLTSIVYVLTPEVAIIG
GGISASAKYFLPAAQQEIDRRVMATSRPGLKLIEAQLGNHAGIAGAAKLAWYLLDRQQAT
GGRGDGGTGR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagtaatcgggatcgacttaggcggtacggcaattaaactagggcgatttact
gaagatgggacttgtcttcagtcattgacagtgccgacgccacaacctgcctatcccgat
gacacgatcgatatgatgacttatgcgatcgagaaattagccccaggattggctaatatt
aacgcgatcggcgtgggtacaccaggccctgcggatgcagtgggacgggtggcgaaggtt
gccatcaatttaaaagggtggatcgatattccggtggcgacgctgatccagtctcgcacg
ggcgtaccgacgattgttggtaacgatgctaattgtgcgggattgggggaaaaatggctg
ggtgcggggcgaaattatcgcaatttagtattattaactctgggtactggcgttggtggc
gcggtgtttctcgatggggtattatttaccggacatgccgggagtgcgggcgaattggga
ttgattgctttcgatccagatgggcatccctgcaatagtggcaataatggctcgttggaa
cagtttctctctgggcaagcgattcgacgcctgacgggtaaagagccgaaagagctgggg
atattggccgcagcaggcgatcgagatgcgttagaattttggaataattacgggcgcaat
ttagggattggattgacgagtatcgtctatgtcctgacgccagaagtcgcaattattggt
ggtggaattagtgccagtgccaagtattttttacccgccgcccaacaagaaatcgatcgc
cgcgtgatggcgacttcgcgtccgggattgaagttaattgaggcacaattgggcaatcat
gccggaattgctggtgctgctaaattggcatggtatctgctcgatcgccagcaggcgaca
gggggacgaggagacggggggacagggcgatag

DBGET integrated database retrieval system