KEGG   Chamaesiphon minutus: Cha6605_5854Help
Entry
Cha6605_5854      CDS       T02414                                 

Definition
putative bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cmp  Chamaesiphon minutus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cha6605_5854
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cha6605_5854
Enzymes [BR:cmp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cha6605_5854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6175241..6177697)
Genome map
AA seq 818 aa AA seqDB search
MLEPSPRPSIPTATWQRQFHQDWEKPYTVRYESNLDDGPFHGMPLGGFGAGCIGRSHRGE
FNLWHIDGGEHVFKNLSACQFSVFEQLANGDSQAYAMSTQAPGDGSLNRWQWYPQTTPTG
QSTGSYQALYPRSWYSYENVFQAQLTCEQFSPIWADNYQETSYPIAVFEWTAHNPTDKPI
TLSIMLTWENTVGWFANTSPSSKVEIRDDGSPVYDYQPRIGESEGNFNQWIVDNYRVGCL
LDKAHKSDIPSEGEGQWSIASIANPSLEVFYHSRWNPIGNGGEIWDSFAADGSLPDIDDE
SEAKQRERIATAITIRFTVKPGQTKKIPFILAWDFPVTEFGKGINYYRRYTDFFGRSGEN
SWAMVRTALKHSDTWQEQIINWQQPILDRSDLPDWFKMALFNELYLLTDGGTIWSAADDR
DPVGQFGVLECLDYRWYESLDVRLYGSFSVLLLWPKLEKSILIAFARAIDTEDTNKRLIG
YYVQTAFGYEDRPQNVDRDAMMAPRKTLHATPHDLGAPNEHPWEKTNYTCYQDCNLWKDL
GSDFVLQVYRAYIFTGKKDLEFLAECWTAIVDTLAYLKQFDLDNDGIIENSGAPDQTFDD
WRLQGISAYCGGLWLAALEAAISIGNILTQQYHGELTPKPAEVIPQYQAWLDSGKPIYQQ
QLWNGSYYRIDTGSGSEVVMADQLCGQFYTQLLELDDIVPPDCAKTALQTVYQSCFLNFQ
GGKFGAANGVKIDGSPSNPKDTHPLEVWTGINFGIAAFLVQMGMQEEALKLAETIVEQVY
SNGLQFRTPEAITSAGTFRASHYLRAMAIWGIYHTLGD
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaccctcaccacgtccgtcgattcctactgctacttggcaacgtcagtttcat
caagactgggaaaaaccctatacagtacgctatgagagtaacctagacgatgggcctttt
catgggatgccactagggggatttggtgcgggatgtatcggcagatcccatcgcggtgag
ttcaatctgtggcacatcgacggcggcgaacatgtttttaaaaacctctcggcttgtcag
tttagtgtcttcgagcagttggctaatggcgatagtcaagcttatgcaatgtctacgcaa
gcaccgggagatggtagtttaaatcgttggcaatggtaccctcagacgacgcctacaggg
caatcaacgggtagttatcaggctttatatccccgcagttggtacagttatgaaaatgtc
ttccaggcgcaattaacttgcgaacagttttcgccgatttgggcggataattatcaggag
acttcttatccgatcgcggtatttgaatggactgctcataatccgacagacaaaccaatt
accttgagcattatgctgacatgggaaaatactgtcggttggtttgcaaataccagtcca
tcgagtaaggtagaaattcgcgatgatggtagtcccgtctatgattaccaacctcgcatc
ggcgaaagtgaggggaatttcaatcagtggattgtcgataattatcgtgtcggttgtttg
ctcgataaagcacacaaatccgacataccgagtgagggtgaaggacaatggtcgatcgcg
agtattgccaatcccagtctcgaagtattttatcattcgcgctggaatccgatcgggaat
ggtggcgagatttgggatagttttgccgccgatggttcgctgccagatatcgatgatgaa
agtgaggcaaaacagagagaaagaattgccacagcaattacaattcgatttacagtcaaa
cccggacaaactaaaaagattccgtttattctcgcttgggattttccagttacggaattt
ggtaaagggataaattattatcgccgttatacagatttcttcggtcgatcgggtgaaaat
agttgggcgatggtacgtaccgctctgaagcattccgatacttggcaagaacaaataatt
aactggcaacaaccaattctcgatcgatccgatttgccagattggttcaagatggccttg
tttaacgagttatatttacttaccgatggcggaacaatatggtctgctgctgacgatcgc
gatccggtcggacaatttggggtattagaatgtttagattaccgctggtatgaaagttta
gatgttcgtctatatggctccttttccgtactcttactctggccgaaattagaaaagtca
attctaattgccttcgctagagcgatcgatactgaagatactaataaacgcctcatcggt
tactatgtccaaaccgcatttggctatgaagatcgaccccaaaatgtcgatcgtgatgcg
atgatggcaccccgcaaaacgctccatgctaccccccacgatctgggcgcacccaacgaa
catccgtgggaaaaaactaactatacctgctatcaagattgcaatctctggaaagatttg
ggtagtgattttgtcctgcaagtttatcgcgcctatatatttacaggcaaaaaagatctg
gaatttcttgccgaatgttggacggcaattgtcgatactttagcctacctcaaacaattc
gacctcgataacgatggcatcatcgaaaactccggcgcacccgatcaaaccttcgatgat
tggcgactgcaaggcattagtgcttattgtggcggattgtggttggcagcattagaagca
gcaatctcgatcggtaatattctcactcaacaataccacggcgaactaacacctaaaccc
gccgaagtcattcctcaatatcaggcttggttagattccggcaaacctatctatcaacaa
caactctggaatggcagttactaccgcatcgataccggaagcggctccgaagtagtgatg
gcagatcaattatgcggtcaattctacacccagctcttagaactagatgacatcgtgccc
ccagattgcgccaaaactgccctccaaaccgtctatcaatcctgtttcctcaacttccaa
ggcggtaaatttggagccgctaacggcgtcaaaatcgacggatcgccatcgaatcctaaa
gacacccaccccctcgaagtatggacgggaattaacttcggcattgccgcatttttagtc
caaatgggaatgcaagaggaagcattaaaattagccgagacaattgtcgagcaggtatat
agtaacgggttgcaatttagaacccccgaagcgattacctccgctggcacttttcgcgcc
agtcactatctccgcgccatggcaatctggggaatatatcatactctcggtgactaa

DBGET integrated database retrieval system