KEGG   Chamaesiphon minutus: Cha6605_5883Help
Entry
Cha6605_5883      CDS       T02414                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cmp  Chamaesiphon minutus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cha6605_5883
Enzymes [BR:cmp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cha6605_5883
Peptidases [BR:cmp01002]
 Cysteine Peptidases
  Family C44
   Cha6605_5883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6201465..6203237
Genome map
AA seq 590 aa AA seqDB search
MLFGRNKKQATPLPFPRWLVSVGEAGGWTSWFPYPIPSGIVHCKPPHWCSQLDIQSTWCR
DNFGIHRAATGCWALSPSGRFMLVGDVWLSNRQELLATLQIASDLPDIELLAQLWDKWQL
DTPRQLQGMFGLVVCDIEAEQISIVRDPVGARTVYYTAGKTWWIVPQLSSLNPYRSDRLD
PIALRDYLTCSFVPGERTMWQDVREIRPGTILKLPGEQIVSYWQLQQQVVDLESLEWHGD
RLRSQLELVMREYLPTQESVGVFLSGGLDSSCITALATQLHDAPIHTYSIHFGAECANEL
EFSSLVANHCQTHHHILEITFQDMWDKLPETMAYLDDPIGDPLTVPNLLVGRLASQDVSI
TLNGEGGDPCFGGPKNQPMLIDSLYNTGNNYDPLQAYLISFQKCAGDLPQLLKPDIWQQV
QQPWIFEADLNSDMSFLNRLMALNIKFKGADQILTKVNNLTQAAGVQGRSPLFDRRIVEL
SMTIPPEYKLSGIREKAVLKQAVADLLPAAIIDRPKSGMMVPVQLGFRKYWQRQARSILL
NRHALITPYIDRDLIKEWLSFRGDVWGRYGVKLWLLVSLEMWLQANYNRK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgctattcggacggaataaaaagcaagcaacccccttacctttcccacgctggttggtt
tctgttggcgaagcaggcgggtggacttcttggtttccttatccgattccgtcgggaatc
gttcattgcaaaccgccgcactggtgttcgcaactcgatattcaatcgacatggtgtcga
gacaattttgggattcatcgagccgcgactggctgctgggcactcagtcccagtggtaga
tttatgctcgtgggggacgtgtggttgagcaaccgtcaggagttgctagcaacattgcag
attgcctcagatctccccgatatcgaactcctggcgcaactttgggataaatggcaactc
gatacgccccgccagctccaagggatgtttggcttagttgtctgcgatatcgaagcggag
caaatctcgatcgtccgcgatccggtgggggcgagaaccgtttattatactgctggcaaa
acttggtggatcgtacctcaacttagcagtctaaatccttatcgatccgatcgattagat
ccgatcgccttacgcgattatctgacttgttcgtttgtccctggggagcggacgatgtgg
caggatgtacgggaaattcgtccaggaaccatcctcaaattgcccggagagcaaatcgta
tcctactggcaattacaacagcaggtggtcgatttggagtctttagagtggcatggcgat
agattgcgatcgcaattagaactagtcatgagggaatatttacccacacaggaatctgtg
ggtgtgtttctatcaggcggattggattcgagttgcattacggctctagctacccaatta
cacgatgcccccattcatacttattcgattcattttggtgccgaatgtgccaatgaattg
gagttttcgagcctagtcgccaatcattgtcaaacccaccatcacatcttagaaattacc
ttccaagatatgtgggacaaattgccggaaacgatggcatatttagacgatccgatcggc
gatccgttgacagttcctaatttattagtcggacgattagccagtcaggatgtatcgatt
accctcaatggtgaaggtggcgatccatgttttggtggccccaaaaatcaaccaatgtta
atcgatagtttatataatacaggcaataattacgaccctttgcaagcttatctaatctca
ttccaaaagtgtgcgggagatttgccgcaattactcaagccagatatttggcaacaagtt
cagcaaccgtggatttttgaagcagacttaaattcagacatgagttttctgaatcggttg
atggctctaaatatcaaattcaaaggtgccgatcagatcttgactaaagtaaataatctc
actcaggcggctggagtgcaaggtcgatcgccattatttgacaggcggattgtcgagctg
agtatgactattcccccagaatataaactctcaggcatcagggaaaaagccgtattaaaa
caagcagttgcagatttattaccagccgcaataatcgatcgacccaaaagtggcatgatg
gtaccagtccaactcggttttcggaaatattggcaacgtcaggctcgatcgattttacta
aatcggcacgcattaattacaccatatatcgatcgagatctaattaaagaatggttgagt
tttcgcggcgacgtgtggggtagatatggcgtgaaattatggttgttagttagtttggaa
atgtggctacaggcgaattataatcggaagtag

DBGET integrated database retrieval system