KEGG   Chamaesiphon minutus: Cha6605_6131Help
Entry
Cha6605_6131      CDS       T02414                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
cmp  Chamaesiphon minutus
Brite
Enzymes [BR:cmp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Cha6605_6131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pCHA6605.01:169686..170315
Genome map
AA seq 209 aa AA seqDB search
MYTIYAFPTPNSIKVPIALEELNLEYTLHPVNIRQGGQREPDFLTVNPAGKVPVLVEESP
AGQPFVLSESAAILVFLAEKHGKLLPTEQIARARVFEQLFFHASGLSPAFGQSGYFQKLA
PEPVPLAISRFHGEAKRTLGLLDRTLAQHTYVAGDDYAIADIAHFGWLWRRAFAGVDFDE
SPNVARWYESIASRPAVVRAIAKVEALAA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtataccatctacgcatttccgacacccaatagtatcaaggtaccgatcgccttggaa
gaactcaaccttgagtatacgcttcacccagttaatatccgtcaaggcggacagcgcgaa
cctgattttctgacagtgaatcccgctggcaaagttcccgtgcttgtcgaagaaagccct
gcgggtcaaccattcgtactctccgaatccgcagccattctggtttttctggctgaaaaa
catggcaagttgttaccaacagagcagatcgcccgcgctcgcgtatttgaacagctattc
tttcatgcttcgggactcagccccgcctttggacaatcggggtatttccaaaaactggca
cccgaacccgtgcccctagcaatctcgcgctttcatggcgaagctaaacgcacacttggc
ttactcgatcgcaccctagcacaacacacatatgtcgctggtgatgattacgcaattgcc
gacatcgcccacttcggctggttgtggcggcgggcttttgctggtgttgactttgacgag
tctcctaatgtcgcccgttggtatgagtcgatcgcgtcacgtccggctgtggtacgagcg
atcgccaaagtcgaagccctggcagcataa

DBGET integrated database retrieval system