KEGG   Cyclobacterium marinum: Cycma_0359Help
Entry
Cycma_0359        CDS       T01592                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00260  Glycine, serine and threonine metabolism
cmr00750  Vitamin B6 metabolism
cmr01100  Metabolic pathways
cmr01110  Biosynthesis of secondary metabolites
cmr01120  Microbial metabolism in diverse environments
cmr01230  Biosynthesis of amino acids
Module
cmr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cycma_0359
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cycma_0359
Enzymes [BR:cmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cycma_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEL24138
UniProt: G0IUE3
Position
complement(389701..390993)
Genome map
AA seq 430 aa AA seqDB search
MKYYSTNNPNHKVDLKEAVIKGLAPDQGLYMPEKIPVLNSDFFSNIHKLSFKEIGYKVIS
ALFSEDLSQDQIKALVDHTLDFDAPVVPVEQDVFTLELFHGPTLAFKDFGARFCSKLMSM
LQDKGAIKVLVATSGDTGSAVANGFLGVEGVEVVILYPSGKVSELQEKQFTTLGENIHAI
EIEGVFDDCQKMVKEAFLDPELNSKLLLTSANSINIARWIPQCLYYFYAYSRLPKENKKL
AFSVPSGNFGNLAAGILAERMGLPIDMFIAATNVNKVVPDYLSGQAFAPKPSIQTISNSM
DVGNPSNFYRLLALFGGDEEKLKEKVQGCFYTDESTKEAMVNVKAQTGYTMDPHGAVAYL
GLKAFMDKYPDTYQGVFLETAHPGKFRSTVEDALGEALVLPERLAAFMEGEKKVTFMEND
YEQFKKYLLG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatagtaccaataatccgaatcataaagtagatttaaaagaggctgttata
aaagggttggctcctgatcaaggactttacatgcctgaaaaaattccggttttgaattcg
gattttttttcaaacatacacaagctttcttttaaggagattggctataaggtcatttca
gcattgttctccgaagatttatcccaagaccaaatcaaagccttggttgaccatacattg
gattttgatgctcctgtggtgccggtagagcaggatgtgtttacacttgaactcttccat
ggaccaacattggcatttaaggattttggggccaggttttgttccaaattaatgagtatg
cttcaggataaaggagccataaaggtgcttgtagctacttccggggatacaggaagtgcg
gtggccaatggttttttgggtgtggagggtgttgaagttgtaatcctttatccttctggt
aaagtaagtgaactccaagaaaagcagtttactaccttgggtgaaaatattcatgcaatt
gaaatagaaggtgtttttgacgattgccagaaaatggtgaaggaggctttcttggatcct
gaattgaacagtaaacttttactgacttctgccaattcaattaatatagccaggtggatt
cctcaatgcctgtattatttttatgcttattcaagattgccaaaagagaacaaaaaactt
gctttttctgtacctagtggtaattttgggaatttagcagcgggaatattggcggaaaga
atgggtttgccaatagatatgtttattgccgcaaccaatgtgaataaagtggttcccgat
tatttaagtggacaggcatttgctccgaaaccttcaatccaaaccattagtaatagtatg
gatgttgggaacccaagtaatttttataggttgttggctttgtttggcggagatgaagag
aaattaaaggaaaaagttcaaggctgtttctacaccgatgaaagcacaaaagaagccatg
gtaaatgtgaaagcccaaacaggctataccatggatccacacggagctgtagcctacctt
ggccttaaagcttttatggacaagtaccctgatacctatcaaggagtctttctggaaact
gcacatccgggtaaatttagaagtaccgttgaagatgctctgggggaagctttggttttg
ccagaaagattagctgcatttatggaaggtgagaaaaaggttacttttatggaaaatgat
tacgagcagtttaaaaagtatttactcgggtaa

DBGET integrated database retrieval system