KEGG   Cyclobacterium marinum: Cycma_0369Help
Entry
Cycma_0369        CDS       T01592                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
cmr  Cyclobacterium marinum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cycma_0369
DNA repair and recombination proteins [BR:cmr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cycma_0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
400572..401192
Genome map
AA seq 206 aa AA seqDB search
MNFPSKLIEDAVTEISRLPGIGKKTALRLTLHLLKQKEPVTTALTDSLLNLRKNIQYCEV
CHNISDSTICSICEGNKRDKSVICVVEDLPDVLAIENTNQYTGLYHVLGGVISPIQGIGP
DELKIESLIKRIDSPSNETPVDEIILALPATMEGDTTSFFITRKLKDKNIKVSSIARGIP
VGSELEYTDEITLGRSILTRIKYSTE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
ttgaactttccttccaaattaattgaagatgctgtaacagagataagtcgacttcccggc
attggaaaaaaaactgccctacgacttacattacatttgctcaaacaaaaggagcctgta
actacagcgcttacagattcattattaaaccttcgtaaaaacattcaatactgtgaagtc
tgtcacaatatttcagacagtaccatttgcagcatatgcgaggggaataaaagggacaaa
agtgtaatctgtgtggtggaagaccttccagatgtattggctatagaaaataccaaccaa
tatacagggctgtaccatgttttgggaggggttatctctcctatccaaggaattgggcct
gatgaactgaagattgaatcactaatcaaacgcatcgattctcccagcaatgaaactcct
gtcgatgagattattttggcccttccggctaccatggagggtgatactacttcttttttt
atcaccagaaaattaaaagataaaaacattaaagtttcttccatcgccagaggtatacct
gttggaagcgaattagagtatacggatgaaatcaccttagggagaagtattctgactcgc
ataaaatattctacagaataa

DBGET integrated database retrieval system