KEGG   Cyclobacterium marinum: Cycma_0457Help
Entry
Cycma_0457        CDS       T01592                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cmr  Cyclobacterium marinum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cycma_0457
Enzymes [BR:cmr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cycma_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
517655..518257
Genome map
AA seq 200 aa AA seqDB search
MITYLKGKLAFKDPTHVIIDVHGIGYEVKISLNTFGKIEDKEEIMLHTYLHIKEDAHTLY
GFKEASEKKAFLNLISISGVGASTGLMILSSLTVPELEQAISAGDHPTIQRVKGIGAKTA
QRIVLELKDKILKDGIAAPEGVTQGFVQNSNKLKQEALQALITLGFTKAQAEKNIMTVLK
KSGPDVSLEALIKASLKSSS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattacttatctaaaaggaaaactagcattcaaagacccgacacatgtcatcatcgat
gttcatggcattggatatgaagtaaaaatatctttaaatactttcgggaaaatagaagat
aaagaagagatcatgcttcatacttacctgcacattaaagaagatgctcataccctttat
gggttcaaggaagcttctgaaaaaaaagcttttttgaatctgatctctatttcaggtgtt
ggtgcaagcaccggtttaatgattctttctagcctgactgtaccggaactcgaacaggcc
ataagtgcaggtgaccacccgaccattcagcgagttaaagggatcggtgccaaaacagcg
caaaggattgttttggaactaaaagacaaaattttaaaggatggaattgctgcacctgag
ggagtcactcagggctttgtacaaaacagcaataaattaaaacaagaggcgttacaagct
ttgattaccttaggcttcactaaggcccaagcagagaaaaatatcatgactgttttgaaa
aaaagtggtccggatgtttccttagaagcattaattaaagcatctttaaagtcatcatca
taa

DBGET integrated database retrieval system