KEGG   Cyclobacterium marinum: Cycma_0525Help
Entry
Cycma_0525        CDS       T01592                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cmr  Cyclobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cycma_0525
   01230 Biosynthesis of amino acids
    Cycma_0525
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cycma_0525
   00030 Pentose phosphate pathway
    Cycma_0525
   00051 Fructose and mannose metabolism
    Cycma_0525
   00052 Galactose metabolism
    Cycma_0525
  Energy metabolism
   00680 Methane metabolism
    Cycma_0525
Enzymes [BR:cmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cycma_0525
Protein phosphatases and associated proteins [BR:cmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cycma_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
605177..606154
Genome map
AA seq 325 aa AA seqDB search
MKKIAVYTSGGDSPGMNACVRAVVRTGIYHNLDVYSIKYGYDGIINGNISKMESHSVSNI
LQRGGTILKSARSNEFRTKEGRKKAYDQLTKHGIDGLVAIGGDGTFTGAKIFYEEFGIPV
VGCPGTIDNDIYGTDYTIGFDTAVNTALEAIDKIRDTAAAHDRVFFVEVMGRDSGYIAVE
CAIGGGAEVVMVPETITTSKQVSDYLKNLRESKTSSIVVVAEGDEEGDAATIMAKVKSEF
VGEEEKKFKVTTLGHIQRGGSPTAKDRLLGSRSGLAAVEGLLNGKFNCMAGIINDQVVYT
PFDDCINKNKPLNKDYLRLQEILSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcagtttatacctctggtggggattcgcccggaatgaacgcttgcgtc
agggcagtagtaaggacaggaatttatcataacctggatgtatacagcatcaaatacgga
tacgatggcatcatcaatgggaatatttcaaaaatggaatcccattcggttagcaacata
cttcaaaggggcggtaccattttaaaatccgctagaagcaatgaattccgcaccaaagaa
gggagaaaaaaagcctatgatcaattgaccaagcacggcatagatggccttgtggccata
ggtggtgatggtacttttaccggtgctaaaatattttatgaggaattcggaattcctgta
gtaggttgtcccggcaccattgacaacgacatctatggtaccgattacaccattggtttc
gacacagctgtaaatacagctttggaagcaatagataagatcagggatacagcagcagca
catgaccgtgtcttttttgtggaagtaatgggcagagacagtggctatatcgctgtagaa
tgtgccataggcggtggagctgaagtagtgatggtacctgaaacaataaccacctcaaag
caagtgtctgattacttaaaaaatttaagagaatctaaaacatcaagcatagtggtggtg
gccgaaggtgatgaagaaggtgatgcggccaccattatggcaaaagtgaagtccgaattt
gtaggagaagaagaaaagaagtttaaagtgaccacccttgggcatattcagcgaggtggg
agccctacagccaaagataggttattgggtagccgaagcggattggccgcagtagagggc
ttgctaaatggtaaattcaactgtatggccggtattattaatgatcaggtcgtttacact
ccattcgacgattgcatcaacaaaaacaagccattgaacaaagactacttaagattgcaa
gagattttaagtatttaa

DBGET integrated database retrieval system